Citrus Sinensis ID: 013029

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-

MISQFFVLSQRGDNIVFRDYRGEVQKGSAEIFFRKVKFWKDDGEEEAPPVFNVDGVNYFHVKVVGLLFVATTRVNVSPSLVLELLQRIARVIKDYLGVLNEDSLRKNFVLVYELLDEVIDFGYVQTTSTEVLKSYVFNEPIVVDAVRLQPLSPAAIFMQGTKRMPGTAVTKSVVANEPGGRKREEIFVDIIEKISVTFSSSGYILTSEIDGTIQMKSYLTGNPEIRLALNDDLLIGKGGRSIYDYRSSTGSGAVVLDDCNFHESVRLDSFDVDRTLSLVPPDGEFPVMNYRMTQEFKPPFRINTLVEEAGALKAEVIIKISAEFSASITANTIVVEMPLPKYTTRVSFGLEPGAVGQRTDFKEANRRLEWGLKKIVGGSEHTLRAKLTFSQESHGNITKEVGPVNMTFTIPMYNASKLQVKYLQIAKKSSTYNPYRWVRYVTQANSYVARI

cEEEEEEECccccEEEEEcccccccccHHHHHHHHHcccccccccccccEEEEccEEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccHHHHcccccccccEEcccccccccccccccccccccccccCEEEEEcccccccccEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEEEEEccccEEEEEEccccccccccccccccccccccccEEEccccccccccccccccccEEEEEcccccEEEEEEECcccccccEEEEEEEEEcccEEEEEEEEEccccccccEEEEEEEEcccccccCEEEEEEcccccccEEEEEccccEEEEcccECccccEEEEEEEEEECcccccccccccccEEEEEEEcEEEccccEEEEEEEEEccccccccccEEEEEEcccEEEEc

MISQFFVLSQRGDNIVFRDYRGEVQKGSAEIFFRKVKFWKDDGEEEAPPVFNVDGVNYFHVKVVGLLFVATTRVNVSPSLVLELLQRIARVIKDYLGVLNEDSLRKNFVLVYELLDEVIDFGYVQTTSTEVLKSYVFNEPIVVDAV***************KR****AV***VVANEPGGRKREEIFVDIIEKISVTFSSSGYILTSEIDGTIQMKSYLTGNPEIRLALNDDLLIGKG************SGAVVLDDCNFHESVRLDSFDVDRTLSLVPPDGEFPVMNYRMTQEFKPPFRINTLVEEAGALKAEVIIKISAEFSASITANTIVVEMPLPKYTTRVSFGLEPGAVGQRTDFKEANRRLEWGLKKIVGGSEHTLRAKLTFSQESH***TKEVGPVNMTFTIPMYNASKLQVKYLQIAKKSSTYNPYRWVRYVTQANSYVARI

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
AP-4 complex subunit mu-1	Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.	probable	Q9JKC7
AP-4 complex subunit mu-1	Subunit of novel type of clathrin- or non-clathrin-associated protein coat involved in targeting proteins from the trans-Golgi network (TGN) to the endosomal-lysosomal system.	probable	Q2PWT8
AP-1 complex subunit mu-1	Component of the adaptor complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration.	probable	Q9HFE5

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W63, chain M
Confidence level:very confident
Coverage over the Query: 1-146,173-232,254-389,401-451
View the alignment between query and template
View the model in PyMOL

Template: 2BP5, chain M
Confidence level:confident
Coverage over the Query: 182-232,253-451
View the alignment between query and template
View the model in PyMOL