Citrus Sinensis ID: 013039

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-

MGTQGPATTDQNYNHATSEEQAAKQKAIDDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVAILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNAIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTPEKPSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKVEDNILLSLEKPTWLIVMANFFVVVHVIGSYQIYAMPVFDMIETLLVKKLNFSPTRLLRFVVRNLYVASTMFIGITFPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWCINWICIVLGLCLMILSPIGGLRQIILQAKDYKFYS

ccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHcHHHcHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHcccccccEEHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccEEccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHEEcEEcccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc

****************************DDWLPITSSRNAKWWYSAFHNVTAMVGAGVLSLPYAMAQLGWGPGVAILILSWIITLYTLWQMVEMHEMVPGKRFDRYHELGQHAFGEKLGLYIVVPQQLIVEVGVCIVYMVTGGKSLHKVHELLCKEPCKEIKLSYFIMIFASVHFVLSHLPNFNAIAGVSLAAAVMSLSYSTIAWSASVRKGVQPDVAYGYKAKTAAGTVFNFFSALGDVAFAYAGHNVVLEIQATIPSTP**PSKGPMWRGVVVAYIVVALCYFPVALIGYWMFGNKVEDNILLSLEKPTWLIVMANFFVVVHVIGSYQIYAMPVFDMIETLLVKKLNFSPTRLLRFVVRNLYVASTMFIGITFPFFGGLLGFFGGFAFAPTTYFLPCIIWLAIYKPRKYSLSWCINWICIVLGLCLMILSPIGGLRQIILQAKDYKFYS

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxHHxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Lysine histidine transporter 1	Amino acid-proton symporter. Transporter with a broad specificity for histidine, lysine, glutamic acid, alanine, serine, proline and glycine. Involved in both apoplastic transport of amino acids in leaves and their uptake by roots.	confident	Q9FKS8
Lysine histidine transporter 2	Amino acid-proton symporter. Transporter with a broad specificity for neutral and acidic amino acids. Basic amino acids are only marginally transported. Involved in import of amino acids into the tapetum cells for synthesis of compounds important for microspore structure.	probable	Q9LRB5
Lysine histidine transporter-like 2	Amino acid transporter.	probable	Q9SR44

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L1L, chain A
Confidence level:confident
Coverage over the Query: 37-219,232-410
View the alignment between query and template
View the model in PyMOL