Citrus Sinensis ID: 013051


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450
MESSILDSIGSEIIGVMTPVSLCMLLVVLLVYSLSPSEQSLSGASDPFRTAANLVYLERPDDSSTQKLEGAVLNALVFVILIAIVTFLLVLLYYYNFTNFLKNYVRFSAFFVLGTMGGSIFLSIIQQFSIPVDAFTCFVLLFNFTIVGVLSLFSGGIPILLRQAYMVCMGIIMAAWFTNLPEWTTWALLLALALYDLFAVLAPGGPLKLLVELASSRDEELPALVYEARPTVSENERNRRSGLRFLLGGVSDSGSVELQVVSRDNADGRENHGNPEYSAVNVGTFGNEMHERSSDEVERLPLVGHLRDGFSSSGSSSDRSTSVNRENEIVMEEEMSPLVDMSLLGNNRQRASDSLENSLITDRGIRLGLGDFIFYSVLVGRAAMYDLMTVYACYLAIISGLGCTLILLSVCRRALPALPISITLGVLFYFLTRLLMEPFVVGTTTNLLMF
cccHHHcHHHHHHHEEEHHHHHHHHHHHHHHHHccccccccccccccccccccEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccEEEcccccccccccccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHccccccccccccccccccccccccHHHcccccccEEEcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
****ILDSIGSEIIGVMTPVSLCMLLVVLLVYSLSPSEQSLSGASDPFRTAANLVYLERPD*SSTQKLEGAVLNALVFVILIAIVTFLLVLLYYYNFTNFLKNYVRFSAFFVLGTMGGSIFLSIIQQFSIPVDAFTCFVLLFNFTIVGVLSLFSGGIPILLRQAYMVCMGIIMAAWFTNLPEWTTWALLLALALYDLFAVLAPGGPLKLLVELASSRDEELPALVYEA*************************************************************************************************************************************DRGIRLGLGDFIFYSVLVGRAAMYDLMTVYACYLAIISGLGCTLILLSVCRRALPALPISITLGVLFYFLTRLLMEPFVVGTTTNLLMF
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxHxxHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESSILDSIGSEIIGVMTPVSLCMLLVVLLVYSLSPSEQSLSGASDPFRTAANLVYLERPDDSSTQKLEGAVLNALVFVILIAIVTFLLVLLYYYNFTNFLKNYVRFSAFFVLGTMGGSIFLSIIQQFSIPVDAFTCFVLLFNFTIVGVLSLFSGGIPILLRQAYMVCMGIIMAAWFTNLPEWTTWALLLALALYDLFAVLAPGGPLKLLVELASSRDEELPALVYEARPTVSENERNRRSGLRFLLGGVSDSGSVELQVVSRDNADGRENHGNPEYSAVNVGTFGNEMHERSSDEVERLPLVGHLRDGFSSSGSSSDRSTSVNRENEIVMEEEMSPLVDMSLLGNNRQRASDSLENSLITDRGIRLGLGDFIFYSVLVGRAAMYDLMTVYACYLAIISGLGCTLILLSVCRRALPALPISITLGVLFYFLTRLLMEPFVVGTTTNLLMF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Presenilin-like protein At1g08700 Probable subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.probableO64668
Presenilin-1 Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors.probableQ9W6T7
Presenilin sel-12 Probable catalytic subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors (lin-12 or glp-1). Provides the major presenilin function compared to hop-1 and spe-4. Required cell-autonomously for correct neurite connectivity of the AIY cholinergic interneurons and their correct functioning in thermotaxis. Required for mesodermal patterning of muscle function.probableP52166

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KR6, chain A
Confidence level:very confident
Coverage over the Query: 360-450
View the alignment between query and template
View the model in PyMOL
Template: 4HYG, chain A
Confidence level:confident
Coverage over the Query: 71-216
View the alignment between query and template
View the model in PyMOL