Citrus Sinensis ID: 013076

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450

MGGAMSFSKWVFVVFVLHLLNPCPVRFSYGSSSSNGLSDIPKKLLNFAKRQELVGWMIGIRRKIHQNPELGYQEFETSQLIRSELDKMGIKYKHPVAVTGVVGFIGTGEPPFVALRADMDSLPLQEMVEWEYKSKIPGKMHACGHDGHVTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESIHSPYFTLNEDALPYGAALHASLALRYLLEFGPEISLPEGNYRDEL

ccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHccccEECcccccEEEEEEccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHccccccccEEEEEccccccccEEEEEccccccccccEEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHcccccccccEEEEEEEECccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEcccccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHccccEEEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccc

******FSKWVFVVFVLHLLNPCPVRFSYGS*****LSDIPKKLLNFAKRQELVGWMIGIRRKIHQNPELGYQEFETSQLIRSELDKMGIKYKHPVAVTGVVGFIGTGEPPFVALRADMDSLPLQEMVEWEYKSKIPGKMHACGHDGHVTMLLGAAKILQEHREELKGTVVLVFQPAEEGGGGAHKVLEAGVLEKVNAIFGLHVDPNLPIGEVASRPGPLLAGSGFFEAVIGGKGGHAAIPQHSIDPILAASNVIVSLQHLVSREADPLDSQVVTVAKFQGGGAFNVIPDSVLIGGTFRAFSKESFTQLKQRIEEVIIGQAAVQRCSATVDFLSKEKPFFPPTINNNDLHKYFQTVAGDMLDTQKVKVMAPVMGSEDFSFYQEVMPGYFFFLGMKNETLGKVESIHSPYFTLNEDALPYGAALHASLALRYLLEFG**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
IAA-amino acid hydrolase ILR1-like 1	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	confident	Q8S9S4
IAA-amino acid hydrolase ILR1-like 1	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA).	probable	Q84XG9
IAA-amino acid hydrolase ILR1-like 4	Hydrolyzes certain amino acid conjugates of the plant growth regulator indole-3-acetic acid (IAA), including IAA-Ala.	probable	O04373

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XMB, chain A
Confidence level:very confident
Coverage over the Query: 43-437
View the alignment between query and template
View the model in PyMOL