Citrus Sinensis ID: 013117


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MKAAQTPHKKEVPCVFGRPPQLPITKIIRLSAALLARHRRCSTPTAALSLPPRVCSLRPESLSCRLSTIYSWHFTGKTKLCSVDAAMATTKPRLSSFSRNLSAVSSSQTPGVKCGPNGTMFVSSGIADLDKILGGGFPLGSLVMVMEDAEAPHHMLLLRNFMSQGLVHGQPLLYASPSKDPRGFLGTLPSPASLKHDKSRDRESEQEKGLRIAWQYKKYMGENQPNFDSHRDNKQDYCNEFDFRKPLERHYFTRQRVNCVGIQHSKNLAALQEHCASFLAQHQRNDGSSALAGRIAIQSLCAPQCEHSNMDWEMLSFIKSLKGMVRSSNAVVVITFPPSLLSLSSTKRWQHMADTLLSVAAIPDEDKELAKLLSGYQDMVGLLNVHKVARLNTQVPLILEATTFSIKLQKRRFLVLECLNQAPVDGSSGSSYGTSGSCSGSSKAGTLDF
cccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEECcccccccccccccccccccccccccccccccccccccccccccccEEECcccHHHHHHHccccccccEEEEEEcccccHHHHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHcccCEEEEECccccccHHHHHHHHHHccEEEEEEcccccHHHHHHHHcccccccEEEEEEEEccccccccccccccEEEEEEcccccEEEEECcccccccccccccccccccccccccccccc
************PCVFGRPPQLPITKIIRLSAALLARHRRCSTPTAALSLPPRVCSLRPESLSCRLSTIYSWHFTGKT***********************************CGPNGTMFVSSGIADLDKILGGGFPLGSLVMVMEDAEAPHHMLLLRNFMSQGLVHGQPLLYASPSKDPRGFL************************LRIAWQYKKYM****************YCNEFDFRKPLERHYFTRQRVNCVGIQHSKNLAALQEHCASFLAQHQRN*GSSALAGRIAIQSLCAPQCEHSNMDWEMLSFIKSLKGMVRSSNAVVVITFPPSLLSLSSTKRWQHMADTLLSVAAIPDEDKELAKLLSGYQDMVGLLNVHKVARLNTQVPLILEATTFSIKLQKRRFLVLECLNQ****************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAAQTPHKKEVPCVFGRPPQLPITKIIRLSAALLARHRRCSTPTAALSLPPRVCSLRPESLSCRLSTIYSWHFTGKTKLCSVDAAMATTKPRLSSFSRNLSAVSSSQTPGVKCGPNGTMFVSSGIADLDKILGGGFPLGSLVMVMEDAEAPHHMLLLRNFMSQGLVHGQPLLYASPSKDPRGFLGTLPSPASLKHDKSRDRESEQEKGLRIAWQYKKYMGENQPNFDSHRDNKQDYCNEFDFRKPLERHYFTRQRVNCVGIQHSKNLAALQEHCASFLAQHQRNDGSSALAGRIAIQSLCAPQCEHSNMDWEMLSFIKSLKGMVRSSNAVVVITFPPSLLSLSSTKRWQHMADTLLSVAAIPDEDKELAKLLSGYQDMVGLLNVHKVARLNTQVPLILEATTFSIKLQKRRFLVLECLNQAPVDGSSGSSYGTSGSCSGSSKAGTLDF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Elongator complex protein 4 Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Promotes organs development by modulating cell division rate. May regulate mechanisms producing carbon assimilates or importing sucrose. Involved in the repression of the abscisic acid (ABA) signaling pathway during seed germination and seedling growth. Required for auxin distribution or signaling. Involved in oxidative stress signaling. Prevents anthocyanins accumulation.probableQ9C778

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1TF7, chain A
Confidence level:very confident
Coverage over the Query: 118-191,213-224,238-365,377-418
View the alignment between query and template
View the model in PyMOL
Template: 2DR3, chain A
Confidence level:confident
Coverage over the Query: 120-221,245-364,376-418
View the alignment between query and template
View the model in PyMOL
Template: 4EJS, chain A
Confidence level:probable
Coverage over the Query: 236-245,256-334
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
4a8j, chain Avery confident Alignment | Template Structure