Citrus Sinensis ID: 013124


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
cEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEccccHHccccccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHcccccEEEEcccccccccEEEEEEccccEEEEEEEEEccccccHHHHHEEEEEEEEEEcccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHcccccHHHHHccccccccccccccccccccccccEEEEEEccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccEEHHHHHHHHHcccHHHHHHccccccccccccccccccccEEEEccccccHHHHcccccccccccccccEEEEEEcEEEcccc
cEEEEEccccccccccccccccEcccccccccccHHHHHccccccEEEEEEHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHccccHHEHHHHHHHcccEEEEEEcccccccEEEEEEEcccEEEEEEEEEEEcccccHHHHHHHHHHHccccccccccccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHccccccHHHHHHcccccccccccEEcccccccEEEEEEEEEEccccccccccHcHHHHHHHHHHHHHHHHcccHccHHHHHEccccccEEEHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccEEHHHHHHHHHcccccHHHHHccccccccccccccccEEcEEEEEEEEccHHHHcccccccccccccccEEEEEccEEccccc
MVAVVdsnnlsipnlntngnesrvgykrsvprsnsgyvssimgecciscttfniLAPIYKrldhqnqslresdvrdswfNRNQTILDWLICERSSVICLQerlgnagyntfslartnnrgdgLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVvpffqnqgggqqEILIVNThllfphdsslsvvRLHQVYKILQYLELYQTenklnhipiilcgdwngskrghVYKFLRsqgfvssydvahqytdgdadahkwvshrnhrgnicgvdfiwlrnpnqsrkplqASWAEAVFSIIKCQLQKASLAENDAFaffkadnngdviTHSAFCEALRQVNLaglpyglsfqetddlwaqadvdgngvvnYEEFKQRMWNLSCSAQIENncndnmedskdcsekeiLGFAvkdaflfpsevekgkwpenyslsdhaplsvvfspvrmqsss
mvavvdsnnlsipnlntngnesrvgykrsvPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLresdvrdswfNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPenyslsdhaplsvvfspvrmqsss
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
***********************************GYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNC***********EKEILGFAVKDAFLFPSEVEKGKWPENYSL*******************
**********************************************ISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRK*LQASWAEAVFSIIKCQL**********FA**KADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNL**************************GFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFS********
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQI***************EKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAVVDSNNLSIPNLNTNGNESRVGYKRSVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQERLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query449 2.2.26 [Sep-21-2011]
O81916484 Uncharacterized calcium-b yes no 0.926 0.859 0.655 1e-163
Q9LS39448 Carbon catabolite repress no no 0.331 0.332 0.3 2e-08
Q24239354 Protein angel OS=Drosophi yes no 0.329 0.418 0.278 2e-07
Q0WKY2454 Carbon catabolite repress no no 0.414 0.409 0.245 5e-07
Q8VYU4 754 Carbon catabolite repress no no 0.342 0.204 0.242 9e-07
Q8W0Z9602 Carbon catabolite repress no no 0.305 0.227 0.257 3e-06
Q9M2F8603 Carbon catabolite repress no no 0.309 0.230 0.270 5e-05
Q5VTE6544 Protein angel homolog 2 O yes no 0.336 0.277 0.232 0.0009
>sp|O81916|YC22_ARATH Uncharacterized calcium-binding protein At1g02270 OS=Arabidopsis thaliana GN=At1g02270 PE=2 SV=2 Back     alignment and function desciption
 Score =  575 bits (1483), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 285/435 (65%), Positives = 337/435 (77%), Gaps = 19/435 (4%)

Query: 29  SVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDW 88
           SV R NS   SS M E  ISCTTFNILAPIYKR+D +N S RESD R  W  RNQ ILD 
Sbjct: 54  SVMRLNSNLASS-MVESNISCTTFNILAPIYKRVDQKNHSTRESDFRTLWLARNQRILDL 112

Query: 89  LICERSSVICLQE--------------RLGNAGYNTFSLARTNNRGDGLLTALHRDYFNV 134
           L+ +RSSVICLQE              +L ++GY  + LARTN+RGDGLLTA+H+D+F V
Sbjct: 113 LLHQRSSVICLQEVWVGNEELVNMYHHQLSSSGYTIYQLARTNSRGDGLLTAIHKDHFKV 172

Query: 135 LNYRELLFNDFGDRVAQLVHVESVVPFFQN-QGGGQQEILIVNTHLLFPHDSSLSVVRLH 193
           +NYRELLFNDFGDRVAQL+HV++V+PF  N +   QQE++IVNTHLLFPHDSSLS+VRLH
Sbjct: 173 VNYRELLFNDFGDRVAQLLHVKTVIPFPLNGKQDVQQEVIIVNTHLLFPHDSSLSIVRLH 232

Query: 194 QVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGD 253
           QVYKIL+YLE YQ ENKLNH+PIILCGDWNGSKRGHVYKFLRSQGF+SSYD AHQYTD  
Sbjct: 233 QVYKILEYLEAYQKENKLNHMPIILCGDWNGSKRGHVYKFLRSQGFISSYDDAHQYTD-- 290

Query: 254 ADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDA 313
           +DAH+WVSHRNHRGNICGVDFIWL NP+ SRKPL+ SW EAVFSIIK QL KAS+AE+DA
Sbjct: 291 SDAHRWVSHRNHRGNICGVDFIWLCNPSDSRKPLRTSWVEAVFSIIKYQLHKASIAEDDA 350

Query: 314 FAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFK 373
           F F  A N+ D +T+S FC AL++VNL G+P+GLSF+ET +LW +AD+DGNGV +YEE K
Sbjct: 351 FTFLGAKNHSDSLTYSDFCLALQKVNLTGIPHGLSFEETKELWVRADLDGNGVFDYEELK 410

Query: 374 QRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSDH 433
            ++WN++   Q  N     ME  K+  E E +G  V  A LFP E EKG WPENY++SDH
Sbjct: 411 -KIWNMTMVNQPGNCKESVMESKKEEGEDEAIGLKVNKAILFPQEAEKGLWPENYNISDH 469

Query: 434 APLSVVFSPVRMQSS 448
           A L+V FSPV+M  S
Sbjct: 470 ACLTVQFSPVKMLCS 484





Arabidopsis thaliana (taxid: 3702)
>sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homolog 3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2 Back     alignment and function description
>sp|Q24239|ANGEL_DROME Protein angel OS=Drosophila melanogaster GN=angel PE=1 SV=2 Back     alignment and function description
>sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2 Back     alignment and function description
>sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homolog 6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2 Back     alignment and function description
>sp|Q8W0Z9|CCR4A_ARATH Carbon catabolite repressor protein 4 homolog 1 OS=Arabidopsis thaliana GN=CCR4-1 PE=2 SV=1 Back     alignment and function description
>sp|Q9M2F8|CCR4B_ARATH Carbon catabolite repressor protein 4 homolog 2 OS=Arabidopsis thaliana GN=CCR4-2 PE=2 SV=2 Back     alignment and function description
>sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens GN=ANGEL2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query449
255548127471 carbon catabolite repressor protein, put 0.982 0.936 0.708 0.0
224130716429 predicted protein [Populus trichocarpa] 0.902 0.944 0.730 1e-180
296089038485 unnamed protein product [Vitis vinifera] 0.904 0.837 0.723 1e-174
225453682431 PREDICTED: uncharacterized calcium-bindi 0.899 0.937 0.724 1e-174
225455177451 PREDICTED: uncharacterized calcium-bindi 0.886 0.882 0.679 1e-163
147837828445 hypothetical protein VITISV_034892 [Viti 0.886 0.894 0.679 1e-162
356559426473 PREDICTED: uncharacterized calcium-bindi 0.928 0.881 0.649 1e-162
297848430484 endonuclease/exonuclease/phosphatase fam 0.926 0.859 0.657 1e-162
18378941484 uncharacterized calcium-binding protein 0.926 0.859 0.655 1e-161
356522458477 PREDICTED: uncharacterized calcium-bindi 0.897 0.844 0.660 1e-161
>gi|255548127|ref|XP_002515120.1| carbon catabolite repressor protein, putative [Ricinus communis] gi|223545600|gb|EEF47104.1| carbon catabolite repressor protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/474 (70%), Positives = 379/474 (79%), Gaps = 33/474 (6%)

Query: 1   MVAVVDSNNLSIPNLNTNGNES-------RVGYKRSVPRSNSGYVSS--IMGECCISCTT 51
           MVAVV+SN       N+ GNE+             +V R++SG++SS  ++ E CISCTT
Sbjct: 1   MVAVVESNG------NSGGNEANNVLNGITTAAAAAVSRTSSGFLSSTTMLDEPCISCTT 54

Query: 52  FNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQE---------- 101
           FNILAPIYKRLDHQNQS+RESD R  WF RNQ ILDWL+ ERSS+ICLQE          
Sbjct: 55  FNILAPIYKRLDHQNQSIRESDFRAFWFTRNQRILDWLLYERSSIICLQEFWVGNEELVR 114

Query: 102 ----RLGNAGYNTFSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFGDRVAQLVHVES 157
               RLG+AGY TF LARTNNRGDGLLTA+H+DYF VLNY+ELLFNDFGDRVAQL+HV+S
Sbjct: 115 MYEERLGDAGYITFQLARTNNRGDGLLTAVHKDYFTVLNYQELLFNDFGDRVAQLLHVQS 174

Query: 158 VVPFFQNQGGG-QQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENKLNHIPI 216
            VP  Q Q G  QQE LIVNTHLLFPHDSSLS+VRLHQVYKILQY+E YQ +NKL+H+PI
Sbjct: 175 AVPLLQCQTGDVQQEFLIVNTHLLFPHDSSLSIVRLHQVYKILQYVETYQRDNKLSHMPI 234

Query: 217 ILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIW 276
           ILCGDWNGSKRGHVYKFLRSQGFVSSYD+AHQYTD DADAHKWVSHRNHRGNICGVDFIW
Sbjct: 235 ILCGDWNGSKRGHVYKFLRSQGFVSSYDIAHQYTDSDADAHKWVSHRNHRGNICGVDFIW 294

Query: 277 LRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFFKADNNGDVITHSAFCEALR 336
           LRNPN+S+KPL+ SW EAVF IIKCQL KASL ENDAFAF KAD  GD IT+SAFCE LR
Sbjct: 295 LRNPNKSKKPLKTSWYEAVFGIIKCQLLKASLTENDAFAFLKADEPGDFITYSAFCEGLR 354

Query: 337 QVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDS 396
           QVNL GLPYGLSFQ+T DLW +AD+DGNG+V+YEEFK+R+WN SC  Q E  C  ++ED 
Sbjct: 355 QVNLIGLPYGLSFQQTKDLWIRADIDGNGIVDYEEFKERIWNSSCPEQ-EEQCPGSIEDP 413

Query: 397 KDCSE--KEILGFAVKDAFLFPSEVEKGKWPENYSLSDHAPLSVVFSPVRMQSS 448
           +   E  +  +GFAVK+A LFP E EKG WPENYSLSDHA L+VVFSPVRM SS
Sbjct: 414 EQGKEEGEGAIGFAVKNAVLFPREAEKGLWPENYSLSDHARLTVVFSPVRMHSS 467




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224130716|ref|XP_002320910.1| predicted protein [Populus trichocarpa] gi|222861683|gb|EEE99225.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296089038|emb|CBI38741.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225453682|ref|XP_002268930.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225455177|ref|XP_002270121.1| PREDICTED: uncharacterized calcium-binding protein At1g02270 [Vitis vinifera] gi|302144002|emb|CBI23107.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147837828|emb|CAN73791.1| hypothetical protein VITISV_034892 [Vitis vinifera] Back     alignment and taxonomy information
>gi|356559426|ref|XP_003548000.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Glycine max] Back     alignment and taxonomy information
>gi|297848430|ref|XP_002892096.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis lyrata subsp. lyrata] gi|297337938|gb|EFH68355.1| endonuclease/exonuclease/phosphatase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|18378941|ref|NP_563646.1| uncharacterized calcium-binding protein [Arabidopsis thaliana] gi|148887024|sp|O81916.2|YC22_ARATH RecName: Full=Uncharacterized calcium-binding protein At1g02270 gi|15450673|gb|AAK96608.1| At1g02270/T6A9_9 [Arabidopsis thaliana] gi|17380606|gb|AAL36066.1| At1g02270/T6A9_9 [Arabidopsis thaliana] gi|332189287|gb|AEE27408.1| uncharacterized calcium-binding protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356522458|ref|XP_003529863.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query449
TAIR|locus:2204863484 AT1G02270 "AT1G02270" [Arabido 0.924 0.857 0.653 1.1e-149
TAIR|locus:2166547436 AT5G54130 [Arabidopsis thalian 0.877 0.903 0.647 4.8e-142
TAIR|locus:2832132 754 AT5G11350 "AT5G11350" [Arabido 0.396 0.236 0.263 1e-05
TAIR|locus:504956231454 AT1G73875 "AT1G73875" [Arabido 0.407 0.403 0.253 1.3e-05
FB|FBgn0016762354 angel "angel" [Drosophila mela 0.329 0.418 0.278 2.3e-05
UNIPROTKB|Q96HY3113 CALM3 "CALM1 protein" [Homo sa 0.131 0.522 0.430 5.1e-05
UNIPROTKB|P05419131 P05419 "Neo-calmodulin" [Gallu 0.122 0.419 0.426 0.00022
UNIPROTKB|F2Z4K8148 CALM "Uncharacterized protein" 0.131 0.398 0.430 0.00025
UNIPROTKB|P62149149 CALM "Calmodulin" [Gallus gall 0.131 0.395 0.430 0.0003
UNIPROTKB|P62157149 CALM "Calmodulin" [Bos taurus 0.131 0.395 0.430 0.0003
TAIR|locus:2204863 AT1G02270 "AT1G02270" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1461 (519.4 bits), Expect = 1.1e-149, P = 1.1e-149
 Identities = 285/436 (65%), Positives = 341/436 (78%)

Query:    29 SVPRSNSGYVSSIMGECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDW 88
             SV R NS   SS++ E  ISCTTFNILAPIYKR+D +N S RESD R  W  RNQ ILD 
Sbjct:    54 SVMRLNSNLASSMV-ESNISCTTFNILAPIYKRVDQKNHSTRESDFRTLWLARNQRILDL 112

Query:    89 LICERSSVICLQE--------------RLGNAGYNTFSLARTNNRGDGLLTALHRDYFNV 134
             L+ +RSSVICLQE              +L ++GY  + LARTN+RGDGLLTA+H+D+F V
Sbjct:   113 LLHQRSSVICLQEVWVGNEELVNMYHHQLSSSGYTIYQLARTNSRGDGLLTAIHKDHFKV 172

Query:   135 LNYRELLFNDFGDRVAQLVHVESVVPFFQN-QGGGQQEILIVNTHLLFPHDSSLSVVRLH 193
             +NYRELLFNDFGDRVAQL+HV++V+PF  N +   QQE++IVNTHLLFPHDSSLS+VRLH
Sbjct:   173 VNYRELLFNDFGDRVAQLLHVKTVIPFPLNGKQDVQQEVIIVNTHLLFPHDSSLSIVRLH 232

Query:   194 QVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGD 253
             QVYKIL+YLE YQ ENKLNH+PIILCGDWNGSKRGHVYKFLRSQGF+SSYD AHQYTD  
Sbjct:   233 QVYKILEYLEAYQKENKLNHMPIILCGDWNGSKRGHVYKFLRSQGFISSYDDAHQYTD-- 290

Query:   254 ADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDA 313
             +DAH+WVSHRNHRGNICGVDFIWL NP+ SRKPL+ SW EAVFSIIK QL KAS+AE+DA
Sbjct:   291 SDAHRWVSHRNHRGNICGVDFIWLCNPSDSRKPLRTSWVEAVFSIIKYQLHKASIAEDDA 350

Query:   314 FAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEEFK 373
             F F  A N+ D +T+S FC AL++VNL G+P+GLSF+ET +LW +AD+DGNGV +YEE K
Sbjct:   351 FTFLGAKNHSDSLTYSDFCLALQKVNLTGIPHGLSFEETKELWVRADLDGNGVFDYEELK 410

Query:   374 QRMWNLSCSAQIENNCNDN-MEDSKDCSEKEILGFAVKDAFLFPSEVEKGKWPENYSLSD 432
              ++WN++   Q   NC ++ ME  K+  E E +G  V  A LFP E EKG WPENY++SD
Sbjct:   411 -KIWNMTMVNQ-PGNCKESVMESKKEEGEDEAIGLKVNKAILFPQEAEKGLWPENYNISD 468

Query:   433 HAPLSVVFSPVRMQSS 448
             HA L+V FSPV+M  S
Sbjct:   469 HACLTVQFSPVKMLCS 484




GO:0003824 "catalytic activity" evidence=ISS
GO:0005509 "calcium ion binding" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=IDA
GO:0009409 "response to cold" evidence=IEP
TAIR|locus:2166547 AT5G54130 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2832132 AT5G11350 "AT5G11350" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:504956231 AT1G73875 "AT1G73875" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0016762 angel "angel" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q96HY3 CALM3 "CALM1 protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P05419 P05419 "Neo-calmodulin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4K8 CALM "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P62149 CALM "Calmodulin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P62157 CALM "Calmodulin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O81916YC22_ARATHNo assigned EC number0.65510.92650.8595yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.21.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
gw1.XIV.1980.1
hypothetical protein (416 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
cd09097329 cd09097, Deadenylase_CCR4, C-terminal deadenylase 2e-07
cd09096280 cd09096, Deadenylase_nocturnin, C-terminal deadeny 4e-06
PLN03144606 PLN03144, PLN03144, Carbon catabolite repressor pr 5e-06
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 8e-06
cd09083252 cd09083, EEP-1, Exonuclease-Endonuclease-Phosphata 2e-05
cd08372241 cd08372, EEP, Exonuclease-Endonuclease-Phosphatase 2e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 4e-05
cd09078280 cd09078, nSMase, Neutral sphingomyelinases (nSMase 6e-04
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 7e-04
pfam1383353 pfam13833, EF_hand_6, EF-hand domain pair 0.001
cd09079259 cd09079, RgfB-like, Streptococcus agalactiae RgfB, 0.002
COG5239378 COG5239, CCR4, mRNA deadenylase, exonuclease subun 0.003
pfam0003629 pfam00036, efhand, EF hand 0.003
smart0005429 smart00054, EFh, EF-hand, calcium binding motif 0.003
>gnl|CDD|197331 cd09097, Deadenylase_CCR4, C-terminal deadenylase domain of CCR4 and related domains Back     alignment and domain information
 Score = 52.3 bits (126), Expect = 2e-07
 Identities = 52/212 (24%), Positives = 85/212 (40%), Gaps = 53/212 (25%)

Query: 77  SWFNRNQTILDWLICERSSVICLQE------------RLGNAGYNTF----SLARTNNRG 120
           +W  R Q IL  ++   + ++CLQE             L   GY+      S A+T +  
Sbjct: 26  NWDYRKQNILKEILSYNADILCLQEVETDQYEDFFLPELKQHGYDGVFKPKSRAKTMSEA 85

Query: 121 -----DGLLTALHRDYFNVLNYRELLFN-------------DFGDRV------AQLVHVE 156
                DG         F ++    + FN             D  +RV      A +V +E
Sbjct: 86  ERKHVDGCAIFFKTSKFKLVEKHLIEFNQLAMANADAEGSEDMLNRVMTKDNIALIVVLE 145

Query: 157 SVVPFFQNQGGGQQEILIVNTHLLFPHDSSLSVVRLHQV-------YKILQYLELYQTEN 209
           +    ++   G  Q +++ NTH+ +  +   S V+L Q         KI +    Y  E+
Sbjct: 146 ARETSYEGNKG--QLLIVANTHIHWDPE--FSDVKLVQTMMLLEELEKIAEKFSRYPYED 201

Query: 210 KLNHIPIILCGDWNGSKRGHVYKFLRSQGFVS 241
             + IP+++CGD+N      VY+ L S G VS
Sbjct: 202 SAD-IPLVVCGDFNSLPDSGVYELL-SNGSVS 231


This subfamily contains the C-terminal catalytic domain of the deadenylases, Saccharomyces cerevisiae Ccr4p and two vertebrate homologs (CCR4a and CCR4b), and related domains. CCR4 belongs to the large EEP (exonuclease/endonuclease/phosphatase) superfamily that contains functionally diverse enzymes that share a common catalytic mechanism of cleaving phosphodiester bonds. CCR4 is the major deadenylase subunit of the CCR4-NOT transcription complex, which contains two deadenylase subunits and several noncatalytic subunits. The other deadenylase subunit, Caf1 (called Pop2 in yeast), is a DEDD-type protein and does not belong in this superfamily. Saccharomyces cerevisiae CCR4 (or Ccr4p) is a 3'-5' poly(A) RNA and ssDNA exonuclease. It is the catalytic subunit of the yeast mRNA deadenylase (Ccr4p/Pop2p/Not complex). This complex participates in various ways in mRNA metabolism, including transcription initiation and elongation, and mRNA degradation. Ccr4p degrades both poly(A) and single-stranded DNA. There are two vertebrate homologs of Ccr4p, CCR4a (also called CCR4-NOT transcription complex subunit 6 or CNOT6) and CCR4b (also called CNOT6-like or CNOT6L), which independently associate with other components to form distinct CCR4-NOT multisubunit complexes. The nuclease domain of CNOT6 and CNOT6L exhibits Mg2+-dependent deadenylase activity, with specificity for poly (A) RNA as substrate. CCR4a is a component of P-bodies and is necessary for foci formation. CCR4b regulates p27/Kip1 mRNA levels, thereby influencing cell cycle progression. They both contribute to the prevention of cell death by regulating insulin-like growth factor-binding protein 5. Length = 329

>gnl|CDD|197330 cd09096, Deadenylase_nocturnin, C-terminal deadenylase domain of nocturnin and related domains Back     alignment and domain information
>gnl|CDD|178689 PLN03144, PLN03144, Carbon catabolite repressor protein 4 homolog; Provisional Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|197317 cd09083, EEP-1, Exonuclease-Endonuclease-Phosphatase domain; uncharacterized family 1 Back     alignment and domain information
>gnl|CDD|197306 cd08372, EEP, Exonuclease-Endonuclease-Phosphatase (EEP) domain superfamily Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|197312 cd09078, nSMase, Neutral sphingomyelinases (nSMase) catalyze the hydrolysis of sphingomyelin in biological membranes to ceramide and phosphorylcholine Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|222407 pfam13833, EF_hand_6, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|197313 cd09079, RgfB-like, Streptococcus agalactiae RgfB, part of a putative two component signal transduction system, and related proteins Back     alignment and domain information
>gnl|CDD|227564 COG5239, CCR4, mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|200946 pfam00036, efhand, EF hand Back     alignment and domain information
>gnl|CDD|197492 smart00054, EFh, EF-hand, calcium binding motif Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 449
KOG2338495 consensus Transcriptional effector CCR4-related pr 100.0
PLN03144606 Carbon catabolite repressor protein 4 homolog; Pro 100.0
COG5239378 CCR4 mRNA deadenylase, exonuclease subunit and rel 99.91
PRK11756268 exonuclease III; Provisional 99.86
TIGR03395283 sphingomy sphingomyelin phosphodiesterase. Members 99.84
KOG0620361 consensus Glucose-repressible alcohol dehydrogenas 99.82
COG0708261 XthA Exonuclease III [DNA replication, recombinati 99.81
TIGR00195254 exoDNase_III exodeoxyribonuclease III. The model b 99.79
COG3568259 ElsH Metal-dependent hydrolase [General function p 99.77
KOG3873422 consensus Sphingomyelinase family protein [Signal 99.76
PRK13911250 exodeoxyribonuclease III; Provisional 99.75
TIGR00633255 xth exodeoxyribonuclease III (xth). This family is 99.73
PRK05421263 hypothetical protein; Provisional 99.7
PF03372249 Exo_endo_phos: Endonuclease/Exonuclease/phosphatas 99.63
smart00476276 DNaseIc deoxyribonuclease I. Deoxyribonuclease I c 99.62
PTZ00297 1452 pantothenate kinase; Provisional 99.6
KOG2756349 consensus Predicted Mg2+-dependent phosphodiestera 99.41
PRK15251271 cytolethal distending toxin subunit CdtB; Provisio 99.34
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 99.29
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 99.25
COG2374798 Predicted extracellular nuclease [General function 99.18
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.17
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 99.11
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 99.09
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 99.08
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 98.98
COG3021309 Uncharacterized protein conserved in bacteria [Fun 98.97
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.96
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.95
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.91
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.89
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.89
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.83
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.83
cd0005267 EH Eps15 homology domain; found in proteins implic 98.83
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 98.81
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.77
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.74
KOG0028172 consensus Ca2+-binding protein (centrin/caltractin 98.68
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.65
PTZ00184149 calmodulin; Provisional 98.62
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 98.59
PTZ00183158 centrin; Provisional 98.57
cd0503088 calgranulins Calgranulins: S-100 domain found in p 98.51
PF1465866 EF-hand_9: EF-hand domain 98.47
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 98.46
PTZ00183158 centrin; Provisional 98.46
KOG0037221 consensus Ca2+-binding protein, EF-Hand protein su 98.45
KOG0031171 consensus Myosin regulatory light chain, EF-Hand p 98.43
smart00128310 IPPc Inositol polyphosphate phosphatase, catalytic 98.42
PTZ00184149 calmodulin; Provisional 98.42
KOG0036 463 consensus Predicted mitochondrial carrier protein 98.37
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 98.37
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.33
KOG0041244 consensus Predicted Ca2+-binding protein, EF-Hand 98.3
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 98.17
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 98.06
PLN02964 644 phosphatidylserine decarboxylase 97.91
KOG0036 463 consensus Predicted mitochondrial carrier protein 97.9
KOG0038189 consensus Ca2+-binding kinase interacting protein 97.84
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.84
KOG0377631 consensus Protein serine/threonine phosphatase RDG 97.83
KOG0030152 consensus Myosin essential light chain, EF-Hand pr 97.8
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.77
PLN02964 644 phosphatidylserine decarboxylase 97.74
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 97.72
KOG0044193 consensus Ca2+ sensor (EF-Hand superfamily) [Signa 97.64
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 97.56
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.36
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 97.31
KOG0566 1080 consensus Inositol-1,4,5-triphosphate 5-phosphatas 97.2
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.17
KOG0046 627 consensus Ca2+-binding actin-bundling protein (fim 97.14
KOG4223325 consensus Reticulocalbin, calumenin, DNA supercoil 97.02
KOG4065144 consensus Uncharacterized conserved protein [Funct 96.98
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.94
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.73
KOG00402399 consensus Ca2+-binding actin-bundling protein (spe 96.55
KOG2243 5019 consensus Ca2+ release channel (ryanodine receptor 96.39
PF14529119 Exo_endo_phos_2: Endonuclease-reverse transcriptas 96.34
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 96.04
KOG2643489 consensus Ca2+ binding protein, contains EF-hand m 95.97
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.52
KOG1294335 consensus Apurinic/apyrimidinic endonuclease and r 95.28
KOG0034187 consensus Ca2+/calmodulin-dependent protein phosph 95.04
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 95.01
KOG4251 362 consensus Calcium binding protein [General functio 94.87
PLN03191621 Type I inositol-1,4,5-trisphosphate 5-phosphatase 94.41
KOG4223 325 consensus Reticulocalbin, calumenin, DNA supercoil 94.39
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 94.36
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 94.06
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 94.03
PF0872669 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPr 91.94
COG5239378 CCR4 mRNA deadenylase, exonuclease subunit and rel 91.34
KOG2643 489 consensus Ca2+ binding protein, contains EF-hand m 91.3
PTZ00312356 inositol-1,4,5-triphosphate 5-phosphatase; Provisi 91.25
KOG1029 1118 consensus Endocytic adaptor protein intersectin [S 91.2
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 90.63
KOG0377631 consensus Protein serine/threonine phosphatase RDG 90.31
KOG1955 737 consensus Ral-GTPase effector RALBP1 [Intracellula 89.4
COG5411460 Phosphatidylinositol 5-phosphate phosphatase [Sign 88.16
KOG0042680 consensus Glycerol-3-phosphate dehydrogenase [Ener 88.06
PF08976118 DUF1880: Domain of unknown function (DUF1880); Int 87.76
PF05517154 p25-alpha: p25-alpha ; InterPro: IPR008907 This fa 87.75
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 86.05
KOG4666412 consensus Predicted phosphate acyltransferase, con 85.77
KOG2562493 consensus Protein phosphatase 2 regulatory subunit 83.85
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 83.58
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 82.95
PRK12309391 transaldolase/EF-hand domain-containing protein; P 82.17
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 80.66
KOG1976391 consensus Inositol polyphosphate 5-phosphatase, ty 80.22
KOG4578421 consensus Uncharacterized conserved protein, conta 80.03
>KOG2338 consensus Transcriptional effector CCR4-related protein [Transcription] Back     alignment and domain information
Probab=100.00  E-value=9.5e-40  Score=322.04  Aligned_cols=356  Identities=32%  Similarity=0.382  Sum_probs=259.3

Q ss_pred             cEEEEeeccccccccC---CcccCccccCCCCCCChHhHHHHHHHHHhhCCCcEEEecc------------ccccCCccE
Q 013124           46 CISCTTFNILAPIYKR---LDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQE------------RLGNAGYNT  110 (449)
Q Consensus        46 ~lrv~TyNIl~~~y~~---~~~~~~~~~~~~~~~~w~~R~~~i~~~I~~~~pDIIcLQE------------~l~~~gY~~  110 (449)
                      .|+||||||||+.+.+   ..++.    .+...+.|.+|.+.|+.+|..++|||+||||            .+..+||..
T Consensus       116 ~ftvmSYNILAQ~l~~~~~r~~~~----~s~~~L~W~~R~~~Ll~EL~~~dpDIlCLQEVq~d~~~~~~~~~~~~lGy~~  191 (495)
T KOG2338|consen  116 DFTVMSYNILAQDLLRDIRRLYFP----ESGPALKWLRRSQNLLNELKHYDPDVLCLQEVQEDHYPEFWQPLLGKLGYTG  191 (495)
T ss_pred             ceEEEEehHhHHHHHHHhHHhhcc----CChhhcchhHHhHHHHHHHhhcCCCeeeehhhhhhhhHHHHHHHHhhcCceE
Confidence            7999999999998843   33322    4668899999999999999999999999999            566789999


Q ss_pred             EEeccCCCCCCeEEEEEecCCceEeeeeEEEecccc------CceeeEEeeeeecccccccCCCCceEEEEEeeecCCCC
Q 013124          111 FSLARTNNRGDGLLTALHRDYFNVLNYRELLFNDFG------DRVAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFPHD  184 (449)
Q Consensus       111 ~~~~~~~~~~~G~ai~~r~~~f~i~~~~~~~~~~~~------~rv~~~~~~~~~~~~~~~~~~~g~~v~v~ntHL~~~~~  184 (449)
                      +|..+++.+.+||||+|+.++|+++....+.+.+..      ++|+.++.++..   ...  ..++.|+|+||||.|+| 
T Consensus       192 ~~~r~t~~KthG~ai~w~~~~F~lv~~~~l~y~~~~~~l~n~~NV~lvv~l~f~---~~~--~~sq~ilVanTHLl~np-  265 (495)
T KOG2338|consen  192 FFKRRTGTKTHGVAILWHSAKFKLVNHSELNYFDSGSALANRDNVGLVVSLEFR---LVD--ESSQGILVANTHLLFNP-  265 (495)
T ss_pred             EEEeccCCCCceEEEEEecccceecccchhhcccccchhhcccceeEEEEEEec---ccC--cccCceEEEeeeeeecC-
Confidence            999999889999999999999999999999887654      456666555542   111  13679999999999986 


Q ss_pred             CCchhHHHHHHHHHHHHHHHHHHhccCCCCCEEEeecCCCCCCccchhhhhcCCCcccccccccCCCCCcCcCcccccCC
Q 013124          185 SSLSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQGFVSSYDVAHQYTDGDADAHKWVSHRN  264 (449)
Q Consensus       185 ~~~~~~R~~Q~~~l~~~l~~~~~~~~~~~~pvIl~GDFN~~p~s~~~~~L~~~g~~~~~~~~~~~~~~~~~~~~w~s~~~  264 (449)
                       ..+++|+.|.+.|++.++++.+..+ .+.|+++|||||+.|++++|.+|++.++......++.    ..+.+.|+.. +
T Consensus       266 -~~~~vrL~Q~~iiL~~~~~~~~~~~-~~~pi~l~GDfNt~p~~~~y~fl~~~~l~~~~~~~~~----~e~s~~~~~~-~  338 (495)
T KOG2338|consen  266 -SRSDVRLAQVYIILAELEKMSKSSK-SHWPIFLCGDFNTEPDSPPYLFLTSGPLIYDGRAAHT----IEDSHRYVFS-E  338 (495)
T ss_pred             -cccchhhHHHHHHHHHHHHHHhhcc-cCCCeEEecCCCCCCCCCcchhhhcCCceeccccccc----cccccccccc-c
Confidence             7789999999999999999988664 5789999999999999999999999888776665552    2455556655 3


Q ss_pred             CCCCccccccccccCCCCCCCchhhhhHHHHHHHHHHHhhhhhhhhhhhhccc-cccccCCcccHHHHHHHHHHhccCCC
Q 013124          265 HRGNICGVDFIWLRNPNQSRKPLQASWAEAVFSIIKCQLQKASLAENDAFAFF-KADNNGDVITHSAFCEALRQVNLAGL  343 (449)
Q Consensus       265 ~~~~~~~vD~i~l~~ps~~~~p~~ts~~~a~~~~id~ll~~~~~~~~~~F~~~-D~d~~~G~I~~~el~~~l~~lg~~~~  343 (449)
                      ++...+|.|-               .|..+.+.+.+......+..-.++|... |++.. -..++.|+......+++..+
T Consensus       339 ~~~ge~g~d~---------------~~~~~~~s~~k~~~~~~s~~~~e~~t~~g~~~~~-~~~~~~~h~~~~~~~s~~s~  402 (495)
T KOG2338|consen  339 SRLGEEGEDD---------------EEESAAFSRGKGQLSQASIPKPEIFTATGDKNHL-VELTYSEHESLKVNVSLYSH  402 (495)
T ss_pred             cccCcccccc---------------hhhhhhhccCccccccccCCCccccccccccchh-HHHHHHHhhhhhcccceeec
Confidence            3333344431               1667777777766655555566677655 34333 35667777763344443344


Q ss_pred             CCCCCHHHHHHHHHhhCCCCCcceehHHHHHHHHhhhccccccccccCCcccccccccccccCceeeccccCchhhhcCC
Q 013124          344 PYGLSFQETDDLWAQADVDGNGVVNYEEFKQRMWNLSCSAQIENNCNDNMEDSKDCSEKEILGFAVKDAFLFPSEVEKGK  423 (449)
Q Consensus       344 ~~~~~~~e~~~l~~~~D~d~dG~id~~EF~~~l~~~~~~~~~~~~~~g~~~~~e~~~~~~~~g~~v~~a~l~p~e~~~g~  423 (449)
                      ++.+...  +..+.  |.++.|..+|..=.............+. ..+.-    .-...++++..+--++.+|.|++|+-
T Consensus       403 g~~~~~~--~~~~~--~~gep~vt~~~~~~~g~~dyif~~~~~~-~~~~~----~~~~~~~ikl~~~l~ip~~~e~~k~~  473 (495)
T KOG2338|consen  403 GYGLVHT--ENAWL--DRGEPGVTNYALTWKGTLDYIFYSPGDC-KQSNR----EFEEDEAIKLKGLLRIPSPQEMWKAG  473 (495)
T ss_pred             cccccch--hhccc--cCCCcceecHHhhhccceeeEEeccCcc-cccch----hhhcccceeEEEEecCCCHHHhhccC
Confidence            4544433  33333  8888899999765333322222221111 11111    12345678899999999999999999


Q ss_pred             CCCCCC-CCCCCCeeEEeece
Q 013124          424 WPENYS-LSDHAPLSVVFSPV  443 (449)
Q Consensus       424 w~~~~~-~sd~~~~~~~~~~~  443 (449)
                      ||.++. -|||..|+++|+++
T Consensus       474 ~p~~~~~~SDH~aL~~~~~~~  494 (495)
T KOG2338|consen  474 QPPNGRYGSDHIALVAQFSLV  494 (495)
T ss_pred             CCCCCCCcccceEeeEeeEee
Confidence            999944 49999999999986



>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional Back     alignment and domain information
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>PRK11756 exonuclease III; Provisional Back     alignment and domain information
>TIGR03395 sphingomy sphingomyelin phosphodiesterase Back     alignment and domain information
>KOG0620 consensus Glucose-repressible alcohol dehydrogenase transcriptional effector CCR4 and related proteins [Transcription] Back     alignment and domain information
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00195 exoDNase_III exodeoxyribonuclease III Back     alignment and domain information
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only] Back     alignment and domain information
>KOG3873 consensus Sphingomyelinase family protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK13911 exodeoxyribonuclease III; Provisional Back     alignment and domain information
>TIGR00633 xth exodeoxyribonuclease III (xth) Back     alignment and domain information
>PRK05421 hypothetical protein; Provisional Back     alignment and domain information
>PF03372 Exo_endo_phos: Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family; InterPro: IPR005135 This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling [] Back     alignment and domain information
>smart00476 DNaseIc deoxyribonuclease I Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>KOG2756 consensus Predicted Mg2+-dependent phosphodiesterase TTRAP [Signal transduction mechanisms] Back     alignment and domain information
>PRK15251 cytolethal distending toxin subunit CdtB; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>COG2374 Predicted extracellular nuclease [General function prediction only] Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG3021 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>KOG0028 consensus Ca2+-binding protein (centrin/caltractin), EF-Hand superfamily protein [Cytoskeleton; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0037 consensus Ca2+-binding protein, EF-Hand protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG0031 consensus Myosin regulatory light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>KOG0041 consensus Predicted Ca2+-binding protein, EF-Hand protein superfamily [General function prediction only] Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>KOG0036 consensus Predicted mitochondrial carrier protein [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0038 consensus Ca2+-binding kinase interacting protein (KIP) (EF-Hand protein superfamily) [General function prediction only] Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0030 consensus Myosin essential light chain, EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG0044 consensus Ca2+ sensor (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>KOG0566 consensus Inositol-1,4,5-triphosphate 5-phosphatase (synaptojanin), INP51/INP52/INP53 family [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG0046 consensus Ca2+-binding actin-bundling protein (fimbrin/plastin), EF-Hand protein superfamily [Cytoskeleton] Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4065 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0040 consensus Ca2+-binding actin-bundling protein (spectrin), alpha chain (EF-Hand protein superfamily) [Cytoskeleton] Back     alignment and domain information
>KOG2243 consensus Ca2+ release channel (ryanodine receptor) [Signal transduction mechanisms] Back     alignment and domain information
>PF14529 Exo_endo_phos_2: Endonuclease-reverse transcriptase ; PDB: 2EI9_A 1WDU_B Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG1294 consensus Apurinic/apyrimidinic endonuclease and related enzymes [Replication, recombination and repair] Back     alignment and domain information
>KOG0034 consensus Ca2+/calmodulin-dependent protein phosphatase (calcineurin subunit B), EF-Hand superfamily protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG4251 consensus Calcium binding protein [General function prediction only] Back     alignment and domain information
>PLN03191 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional Back     alignment and domain information
>KOG4223 consensus Reticulocalbin, calumenin, DNA supercoiling factor, and related Ca2+-binding proteins of the CREC family (EF-Hand protein superfamily) [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF08726 EFhand_Ca_insen: Ca2+ insensitive EF hand; InterPro: IPR014837 EF hands are helix-loop-helix binding motifs involved in the regulation of many cellular processes Back     alignment and domain information
>COG5239 CCR4 mRNA deadenylase, exonuclease subunit and related nucleases [RNA processing and modification] Back     alignment and domain information
>KOG2643 consensus Ca2+ binding protein, contains EF-hand motifs [Inorganic ion transport and metabolism] Back     alignment and domain information
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional Back     alignment and domain information
>KOG1029 consensus Endocytic adaptor protein intersectin [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0377 consensus Protein serine/threonine phosphatase RDGC/PPEF, contains STphosphatase and EF-hand domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG1955 consensus Ral-GTPase effector RALBP1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0042 consensus Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF08976 DUF1880: Domain of unknown function (DUF1880); InterPro: IPR015070 This entry represents EF-hand calcium-binding domain-containing protein 6 that negatively regulates the androgen receptor by recruiting histone deacetylase complex, and protein DJ-1 antagonises this inhibition by abrogation of this complex [] Back     alignment and domain information
>PF05517 p25-alpha: p25-alpha ; InterPro: IPR008907 This family encodes a 25 kDa protein that is phosphorylated by a Ser/Thr-Pro kinase [] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>KOG2562 consensus Protein phosphatase 2 regulatory subunit [RNA processing and modification] Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG1976 consensus Inositol polyphosphate 5-phosphatase, type I [Lipid transport and metabolism] Back     alignment and domain information
>KOG4578 consensus Uncharacterized conserved protein, contains KAZAL and TY domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
1y0v_H146 Crystal Structure Of Anthrax Edema Factor (Ef) In C 9e-05
2k0j_A148 Solution Structure Of Cam Complexed To Drp1p Length 9e-05
1cdm_A144 Modulation Of Calmodulin Plasticity In Molecular Re 9e-05
1iq5_A149 CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE 9e-05
1k93_D144 Crystal Structure Of The Adenylyl Cyclase Domain Of 9e-05
2vay_A146 Calmodulin Complexed With Cav1.1 Iq Peptide Length 1e-04
1cm1_A148 Motions Of Calmodulin-Single-Conformer Refinement L 1e-04
1prw_A149 Crystal Structure Of Bovine Brain Ca++ Calmodulin I 1e-04
1up5_B148 Chicken Calmodulin Length = 148 1e-04
4gow_D144 Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX 1e-04
1cdl_A147 Target Enzyme Recognition By Calmodulin: 2.4 Angstr 1e-04
2ix7_A145 Structure Of Apo-Calmodulin Bound To Unconventional 1e-04
3u0k_A440 Crystal Structure Of The Genetically Encoded Calciu 1e-04
1qs7_A145 The 1.8 Angstrom Structure Of Calmodulin Rs20 Pepti 1e-04
1f71_A67 Refined Solution Structure Of Calmodulin C-Terminal 1e-04
1vrk_A148 The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 1e-04
1qtx_A148 The 1.65 Angstrom Structure Of Calmodulin Rs20 Pept 1e-04
1yru_B74 Crystal Structure Analysis Of The Adenylyl Cyclaes 1e-04
1cmf_A73 Nmr Solution Structure Of Apo Calmodulin Carboxy-Te 2e-04
1zot_B69 Crystal Structure Analysis Of The CyaaC-Cam With Pm 2e-04
1xfu_O149 Crystal Structure Of Anthrax Edema Factor (ef) Trun 2e-04
3ek8_A449 Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER L 2e-04
3evu_A449 Crystal Structure Of Calcium Bound Dimeric Gcamp2, 2e-04
1fw4_A71 Crystal Structure Of E. Coli Fragment Tr2c From Cal 2e-04
3evr_A411 Crystal Structure Of Calcium Bound Monomeric Gcamp2 2e-04
3sg3_A449 Crystal Structure Of Gcamp3-D380y Length = 449 2e-04
3sg2_A449 Crystal Structure Of Gcamp2-T116v,D381y Length = 44 2e-04
3sg6_A450 Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) L 2e-04
3ekh_A449 Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER 2e-04
3o77_A415 The Structure Of Ca2+ Sensor (Case-16) Length = 415 2e-04
2f2o_A179 Structure Of Calmodulin Bound To A Calcineurin Pept 2e-04
3o78_A415 The Structure Of Ca2+ Sensor (Case-12) Length = 415 2e-04
3sg5_A448 Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linke 2e-04
3sg4_A448 Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Len 2e-04
2col_B67 Crystal Structure Analysis Of CyaaC-Cam With Pyroph 2e-04
3sg7_A448 Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 4 2e-04
2wel_D150 Crystal Structure Of Su6656-Bound CalciumCALMODULIN 3e-04
4djc_A152 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCA 3e-04
2be6_A150 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaC 3e-04
2ygg_B150 Complex Of Cambr And Cam Length = 150 3e-04
3ewt_A154 Crystal Structure Of Calmodulin Complexed With A Pe 3e-04
1deg_A142 The Linker Of Des-Glu84 Calmodulin Is Bent As Seen 4e-04
1dmo_A148 Calmodulin, Nmr, 30 Structures Length = 148 4e-04
2rrt_A72 Solution Structure Of Magnesium-Bound Form Of Calmo 5e-04
1ooj_A149 Structural Genomics Of Caenorhabditis Elegans : Cal 5e-04
2lv6_A148 The Complex Between Ca-calmodulin And Skeletal Musc 6e-04
2bkh_B149 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 6e-04
1ahr_A146 Calmodulin Mutant With A Two Residue Deletion In Th 6e-04
2bbm_A148 Solution Structure Of A Calmodulin-Target Peptide C 6e-04
4aqr_A149 Crystal Structure Of A Calmodulin In Complex With T 7e-04
2ro9_A69 Solution Structure Of Calcium Bound Soybean Calmodu 7e-04
>pdb|1Y0V|H Chain H, Crystal Structure Of Anthrax Edema Factor (Ef) In Complex With Calmodulin And Pyrophosphate Length = 146 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 9e-05, Method: Composition-based stats. Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 6/65 (9%) Query: 312 DAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEE 371 +AF F D NG + SA LR V + L L+ +E D++ +AD+DG+G VNYEE Sbjct: 85 EAFRVFDKDGNGYI---SA--AELRHV-MTNLGEKLTDEEVDEMIREADIDGDGQVNYEE 138 Query: 372 FKQRM 376 F Q M Sbjct: 139 FVQMM 143
>pdb|2K0J|A Chain A, Solution Structure Of Cam Complexed To Drp1p Length = 148 Back     alignment and structure
>pdb|1CDM|A Chain A, Modulation Of Calmodulin Plasticity In Molecular Recognition On The Basis Of X-Ray Structures Length = 144 Back     alignment and structure
>pdb|1IQ5|A Chain A, CalmodulinNEMATODE CA2+CALMODULIN DEPENDENT KINASE KINASE Fragment Length = 149 Back     alignment and structure
>pdb|1K93|D Chain D, Crystal Structure Of The Adenylyl Cyclase Domain Of Anthrax Edema Factor (Ef) In Complex With Calmodulin Length = 144 Back     alignment and structure
>pdb|2VAY|A Chain A, Calmodulin Complexed With Cav1.1 Iq Peptide Length = 146 Back     alignment and structure
>pdb|1CM1|A Chain A, Motions Of Calmodulin-Single-Conformer Refinement Length = 148 Back     alignment and structure
>pdb|1PRW|A Chain A, Crystal Structure Of Bovine Brain Ca++ Calmodulin In A Compact Form Length = 149 Back     alignment and structure
>pdb|1UP5|B Chain B, Chicken Calmodulin Length = 148 Back     alignment and structure
>pdb|4GOW|D Chain D, Crystal Structure Of Ca2+CAM:KV7.4 (KCNQ4) B HELIX COMPLEX Length = 144 Back     alignment and structure
>pdb|1CDL|A Chain A, Target Enzyme Recognition By Calmodulin: 2.4 Angstroms Structure Of A Calmodulin-Peptide Complex Length = 147 Back     alignment and structure
>pdb|2IX7|A Chain A, Structure Of Apo-Calmodulin Bound To Unconventional Myosin V Length = 145 Back     alignment and structure
>pdb|3U0K|A Chain A, Crystal Structure Of The Genetically Encoded Calcium Indicator Rcamp Length = 440 Back     alignment and structure
>pdb|1QS7|A Chain A, The 1.8 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 145 Back     alignment and structure
>pdb|1F71|A Chain A, Refined Solution Structure Of Calmodulin C-Terminal Domain Length = 67 Back     alignment and structure
>pdb|1VRK|A Chain A, The 1.9 Angstrom Structure Of E84k-Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1QTX|A Chain A, The 1.65 Angstrom Structure Of Calmodulin Rs20 Peptide Complex Length = 148 Back     alignment and structure
>pdb|1YRU|B Chain B, Crystal Structure Analysis Of The Adenylyl Cyclaes Catalytic Domain Of Adenylyl Cyclase Toxin Of Bordetella Pertussis In Presence Of C-Terminal Calmodulin And 1mm Calcium Chloride Length = 74 Back     alignment and structure
>pdb|1CMF|A Chain A, Nmr Solution Structure Of Apo Calmodulin Carboxy-Terminal Domain Length = 73 Back     alignment and structure
>pdb|1ZOT|B Chain B, Crystal Structure Analysis Of The CyaaC-Cam With Pmeapp Length = 69 Back     alignment and structure
>pdb|1XFU|O Chain O, Crystal Structure Of Anthrax Edema Factor (ef) Truncation Mutant, Ef-delta 64 In Complex With Calmodulin Length = 149 Back     alignment and structure
>pdb|3EK8|A Chain A, Calcium-Saturated Gcamp2 T116vG87R MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3EVU|A Chain A, Crystal Structure Of Calcium Bound Dimeric Gcamp2, (#1) Length = 449 Back     alignment and structure
>pdb|1FW4|A Chain A, Crystal Structure Of E. Coli Fragment Tr2c From Calmodulin To 1.7 A Resolution Length = 71 Back     alignment and structure
>pdb|3EVR|A Chain A, Crystal Structure Of Calcium Bound Monomeric Gcamp2 Length = 411 Back     alignment and structure
>pdb|3SG3|A Chain A, Crystal Structure Of Gcamp3-D380y Length = 449 Back     alignment and structure
>pdb|3SG2|A Chain A, Crystal Structure Of Gcamp2-T116v,D381y Length = 449 Back     alignment and structure
>pdb|3SG6|A Chain A, Crystal Structure Of Dimeric Gcamp2-Lia(Linker 1) Length = 450 Back     alignment and structure
>pdb|3EKH|A Chain A, Calcium-Saturated Gcamp2 T116vK378W MUTANT MONOMER Length = 449 Back     alignment and structure
>pdb|3O77|A Chain A, The Structure Of Ca2+ Sensor (Case-16) Length = 415 Back     alignment and structure
>pdb|2F2O|A Chain A, Structure Of Calmodulin Bound To A Calcineurin Peptide: A New Way Of Making An Old Binding Mode Length = 179 Back     alignment and structure
>pdb|3O78|A Chain A, The Structure Of Ca2+ Sensor (Case-12) Length = 415 Back     alignment and structure
>pdb|3SG5|A Chain A, Crystal Structure Of Dimeric Gcamp3-D380y, Qp(Linker 1), Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|3SG4|A Chain A, Crystal Structure Of Gcamp3-D380y, Lp(Linker 2) Length = 448 Back     alignment and structure
>pdb|2COL|B Chain B, Crystal Structure Analysis Of CyaaC-Cam With Pyrophosphate Length = 67 Back     alignment and structure
>pdb|3SG7|A Chain A, Crystal Structure Of Gcamp3-Kf(Linker 1) Length = 448 Back     alignment and structure
>pdb|2WEL|D Chain D, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 150 Back     alignment and structure
>pdb|4DJC|A Chain A, 1.35 A Crystal Structure Of The Nav1.5 Diii-Iv-CaCAM COMPLEX Length = 152 Back     alignment and structure
>pdb|2BE6|A Chain A, 2.0 A Crystal Structure Of The Cav1.2 Iq Domain-CaCAM COMPLEX Length = 150 Back     alignment and structure
>pdb|2YGG|B Chain B, Complex Of Cambr And Cam Length = 150 Back     alignment and structure
>pdb|3EWT|A Chain A, Crystal Structure Of Calmodulin Complexed With A Peptide Length = 154 Back     alignment and structure
>pdb|1DEG|A Chain A, The Linker Of Des-Glu84 Calmodulin Is Bent As Seen In The Crystal Structure Length = 142 Back     alignment and structure
>pdb|1DMO|A Chain A, Calmodulin, Nmr, 30 Structures Length = 148 Back     alignment and structure
>pdb|2RRT|A Chain A, Solution Structure Of Magnesium-Bound Form Of Calmodulin C-Domain E104dE140D MUTANT Length = 72 Back     alignment and structure
>pdb|1OOJ|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Calmodulin Length = 149 Back     alignment and structure
>pdb|2LV6|A Chain A, The Complex Between Ca-calmodulin And Skeletal Muscle Myosin Light Chain Kinase From Combination Of Nmr And Aqueous And Contrast-matched Saxs Data Length = 148 Back     alignment and structure
>pdb|2BKH|B Chain B, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 149 Back     alignment and structure
>pdb|1AHR|A Chain A, Calmodulin Mutant With A Two Residue Deletion In The Central Helix Length = 146 Back     alignment and structure
>pdb|2BBM|A Chain A, Solution Structure Of A Calmodulin-Target Peptide Complex By Multidimensional Nmr Length = 148 Back     alignment and structure
>pdb|4AQR|A Chain A, Crystal Structure Of A Calmodulin In Complex With The Regulatory Domain Of A Plasma-Membrane Ca2+-Atpase Length = 149 Back     alignment and structure
>pdb|2RO9|A Chain A, Solution Structure Of Calcium Bound Soybean Calmodulin Isoform 1 C-Terminal Domain Length = 69 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query449
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alp 3e-21
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM 3e-16
3g6s_A267 Putative endonuclease/exonuclease/phosphatase fami 1e-14
3l1w_A257 Uncharacterized protein; APC29019.2, conserved pro 5e-12
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 1e-10
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 3e-10
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 4e-10
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 8e-10
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 1e-09
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 2e-09
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 2e-09
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 2e-09
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 4e-09
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 5e-09
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 5e-09
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 8e-09
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 9e-09
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 1e-08
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 1e-08
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-08
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-08
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 4e-06
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 2e-08
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-08
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 3e-08
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-08
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 3e-08
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 4e-08
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 2e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 4e-08
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 5e-08
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 3e-05
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 5e-08
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 9e-06
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 5e-08
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 3e-06
2jnf_A158 Troponin C; stretch activated muscle contraction, 6e-08
2jnf_A158 Troponin C; stretch activated muscle contraction, 3e-05
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 7e-08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-05
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 9e-08
1exr_A148 Calmodulin; high resolution, disorder, metal trans 9e-08
1exr_A148 Calmodulin; high resolution, disorder, metal trans 5e-04
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 9e-08
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 7e-05
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 9e-08
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 1e-04
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 5e-06
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 1e-07
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 9e-06
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 1e-07
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 1e-07
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 2e-07
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 3e-05
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-07
3fwb_A161 Cell division control protein 31; gene gating, com 2e-07
3fwb_A161 Cell division control protein 31; gene gating, com 3e-05
3akb_A166 Putative calcium binding protein; EF-hand, metal b 2e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 3e-06
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 3e-07
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 7e-05
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 3e-07
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 3e-07
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 3e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 4e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-06
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-05
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 4e-07
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 2e-05
3lij_A494 Calcium/calmodulin dependent protein kinase with A 4e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 7e-05
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 5e-07
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 5e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 6e-07
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 7e-06
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 7e-07
2f33_A 263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-04
3li6_A66 Calcium-binding protein; calcium signaling protein 7e-07
1y1x_A191 Leishmania major homolog of programmed cell death 7e-07
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 8e-07
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-05
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 9e-07
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-06
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 1e-06
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxi 1e-06
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-06
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 1e-06
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-06
2hps_A186 Coelenterazine-binding protein with bound coelent; 8e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 2e-06
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 2e-06
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 2e-06
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-06
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 1e-04
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 3e-06
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-04
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 3e-06
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 3e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-06
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 3e-04
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 4e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 1e-04
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like fold 5e-06
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 5e-06
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 4e-05
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 6e-06
3teb_A266 Endonuclease/exonuclease/phosphatase; PSI-biology, 6e-06
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 6e-06
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 3e-05
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 6e-06
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 1e-05
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 9e-05
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 7e-04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 3e-05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 3e-05
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 6e-05
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 3e-05
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 4e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 5e-05
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 6e-05
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-04
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 3e-04
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 2e-04
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 2e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 2e-04
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 4e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 3e-04
1c07_A95 Protein (epidermal growth factor receptor pathway 4e-04
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 5e-04
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 5e-04
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 6e-04
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 6e-04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 6e-04
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 7e-04
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 7e-04
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 7e-04
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Length = 398 Back     alignment and structure
 Score = 94.3 bits (233), Expect = 3e-21
 Identities = 41/306 (13%), Positives = 92/306 (30%), Gaps = 57/306 (18%)

Query: 46  CISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQE---- 101
             +   +N+L   Y            +    +W  R + I++ ++   + +I LQE    
Sbjct: 31  SFTVMCYNVLCDKYATRQLYGYCPSWAL---NWEYRKKGIMEEIVNCDADIISLQEVETE 87

Query: 102 --------RLGNAGYNTFSLART---------NNRGDGLLTALHRDYFNVLNYRELLFND 144
                    L   GY+ F   ++             DG       + F ++    + FN 
Sbjct: 88  QYFTLFLPALKERGYDGFFSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQ 147

Query: 145 FGDR----------------------VAQLVHVESVVPFFQNQGGGQQEILIVNTHLLFP 182
                                     V ++                +Q +++ N H+ + 
Sbjct: 148 VAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAGMKPIHAADKQLLIVANAHMHW- 206

Query: 183 HDSSLSVVRLHQVYKILQYLELYQTENKL---------NHIPIILCGDWNGSKRGHVYKF 233
            D   S V+L Q    +  ++    +            N IP++LC D N      V ++
Sbjct: 207 -DPEYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVVEY 265

Query: 234 LRSQGFVSSYDVAHQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPNQSRKPLQASWAE 293
           L + G   ++    +    +   +   + +N            L++  ++      ++  
Sbjct: 266 LSNGGVADNHKDFKELRYNECLMNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNYTF 325

Query: 294 AVFSII 299
               +I
Sbjct: 326 DFKGVI 331


>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Length = 298 Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Length = 267 Back     alignment and structure
>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Length = 257 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Length = 76 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus} PDB: 3i46_A 3i48_A 3i5v_A* 3k55_A Length = 317 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Length = 306 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>3teb_A Endonuclease/exonuclease/phosphatase; PSI-biology, MCSG, midwest center for structural genomics; 2.99A {Leptotrichia buccalis c-1013-b} Length = 266 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Length = 301 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 110 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query449
3ngq_A398 CCR4-NOT transcription complex subunit 6-like; alp 100.0
3l1w_A257 Uncharacterized protein; APC29019.2, conserved pro 99.94
3g6s_A267 Putative endonuclease/exonuclease/phosphatase fami 99.93
3mpr_A298 Putative endonuclease/exonuclease/phosphatase FAM 99.93
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.92
4f1h_A250 Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA com 99.9
4gew_A362 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.9
4gz1_A256 Tyrosyl-DNA phosphodiesterase 2; protein-DNA compl 99.9
4fva_A256 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosy 99.9
3teb_A266 Endonuclease/exonuclease/phosphatase; PSI-biology, 99.88
3i41_A317 Beta-hemolysin; beta toxin, sphingomyelinase, toxi 99.86
1zwx_A301 SMCL, sphingomyelinase-C; dnase1-like fold, beta-h 99.86
1ako_A268 Exonuclease III; AP-endonuclease, DNA repair; 1.70 99.83
2jc4_A256 Exodeoxyribonuclease III; hydrolase, repair phosph 99.83
2ddr_A306 Sphingomyelin phosphodiesterase; DNAse I like fold 99.82
3g91_A265 MTH0212, exodeoxyribonuclease; double-strand speci 99.82
1vyb_A238 ORF2 contains A reverse transcriptase domain; endo 99.81
2jc5_A259 Exodeoxyribonuclease; hydrolase, repair phosphodie 99.8
2o3h_A285 DNA-(apurinic or apyrimidinic site) lyase; APE, en 99.8
2voa_A257 AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP 99.78
1hd7_A318 DNA-(apurinic or apyrimidinic site) lyase; DNA rep 99.77
2j63_A467 AP-endonuclease; base excision repair, lyase; 2.48 99.74
1wdu_A245 TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA 99.74
2a40_B260 Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse 99.7
2ei9_A240 Non-LTR retrotransposon R1BMKS ORF2 protein; four 99.55
1sr4_B261 CDT B, cytolethal distending toxin protein B; bact 99.43
2f1n_A262 CDT B, cytolethal distending toxin subunit B; E.co 99.43
2lv7_A100 Calcium-binding protein 7; metal binding protein; 99.38
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.27
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 99.27
2imq_X282 Salivary nitrophorin; ferrous heme, beta-sandwich, 99.26
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 99.24
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.22
1c07_A95 Protein (epidermal growth factor receptor pathway 99.22
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 99.21
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 99.21
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 99.18
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 99.17
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 99.16
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 99.16
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.16
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 99.16
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 99.16
1i9z_A347 Synaptojanin, phosphatidylinositol phosphate phosp 99.14
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 99.14
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.14
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 99.14
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 99.13
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.13
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 99.13
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 99.13
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 99.12
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 99.12
1qjt_A99 EH1, epidermal growth factor receptor substrate su 99.12
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 99.12
1avs_A90 Troponin C; muscle contraction, calcium-activated, 99.11
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 99.1
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.1
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.09
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 99.09
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.09
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 99.08
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 99.08
3li6_A66 Calcium-binding protein; calcium signaling protein 99.07
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.06
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 99.06
2jq6_A139 EH domain-containing protein 1; metal binding prot 99.05
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 99.04
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.04
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 99.03
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 99.03
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 99.02
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 99.02
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 99.02
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 99.01
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.01
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 99.0
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 99.0
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 99.0
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.0
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.0
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 98.99
3fwb_A161 Cell division control protein 31; gene gating, com 98.99
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 98.99
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.99
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.99
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.99
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.98
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 98.98
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.98
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.97
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 98.97
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.96
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.96
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 98.96
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.96
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.96
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.95
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 98.95
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.95
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.95
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.95
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.95
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.94
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.94
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.94
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.94
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.94
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.94
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.93
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 98.93
3fwb_A161 Cell division control protein 31; gene gating, com 98.93
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.93
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.92
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.92
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.91
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.91
1y1x_A191 Leishmania major homolog of programmed cell death 98.91
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 98.91
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.91
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.91
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.9
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.9
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.9
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.88
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.88
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.88
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.88
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.87
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.87
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 98.87
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.87
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.86
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.86
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.86
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 98.86
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 98.85
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.85
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.85
1y1x_A191 Leishmania major homolog of programmed cell death 98.84
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.84
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.83
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 98.83
2xsw_A357 72 kDa inositol polyphosphate 5-phosphatase; inosi 98.83
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.82
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.82
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 98.82
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.82
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.82
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 98.81
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 98.81
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.81
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.81
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.8
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.8
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 98.8
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 98.8
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.8
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.79
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.79
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 98.79
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.78
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.78
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.78
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.76
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.76
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 98.75
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.75
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.74
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 98.74
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.74
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.74
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.72
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.71
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.71
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.71
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.71
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 98.71
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 98.7
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 98.69
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.69
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.68
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 98.68
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.68
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.67
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.67
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 98.67
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.67
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.67
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.66
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.66
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 98.66
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 98.65
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.64
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 98.64
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.62
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.62
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.62
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.62
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 98.61
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.61
3akb_A166 Putative calcium binding protein; EF-hand, metal b 98.6
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.59
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 98.59
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 98.59
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 98.58
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.58
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.58
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 98.57
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 98.57
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.56
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 98.56
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.55
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.55
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 98.54
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.54
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.53
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.53
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 98.52
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.51
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.51
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.51
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.51
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.51
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 98.49
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.49
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.49
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 98.48
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 98.48
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.47
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.47
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 98.46
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.46
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.45
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.45
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.45
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 98.45
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.45
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.44
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 98.43
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.43
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.42
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 98.42
3lij_A494 Calcium/calmodulin dependent protein kinase with A 98.42
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.42
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 98.41
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.4
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.38
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 98.37
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 98.35
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.34
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.3
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 98.29
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.28
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.25
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.23
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.21
3mtc_A313 Type II inositol-1,4,5-trisphosphate 5-phosphatas; 98.21
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.2
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.18
2hps_A186 Coelenterazine-binding protein with bound coelent; 98.16
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 98.15
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 98.14
4a9c_A316 Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; 98.11
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.01
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.01
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 97.85
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.84
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 97.8
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 97.76
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.73
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 97.72
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 97.7
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 97.69
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 97.58
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 97.55
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 97.52
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 97.51
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 97.49
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.48
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 97.46
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 97.29
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.2
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 97.09
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.07
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 96.88
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 96.68
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 96.58
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.5
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 95.96
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 95.82
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 95.5
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.37
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 95.12
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 94.67
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 94.67
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 94.65
1c07_A95 Protein (epidermal growth factor receptor pathway 94.43
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 94.39
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 94.17
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 94.09
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 93.61
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 93.53
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 93.26
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 93.23
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 93.0
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 92.65
3li6_A66 Calcium-binding protein; calcium signaling protein 92.31
1qjt_A99 EH1, epidermal growth factor receptor substrate su 92.28
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 92.18
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 92.09
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 92.08
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 91.91
1avs_A90 Troponin C; muscle contraction, calcium-activated, 91.63
2jq6_A139 EH domain-containing protein 1; metal binding prot 91.52
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 91.28
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 91.06
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 90.59
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 89.98
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 89.9
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 89.75
1pul_A125 Hypothetical protein C32E8.3 in chromosome I; alph 89.3
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 89.04
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 88.17
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 87.77
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 86.74
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 86.72
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 86.65
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 85.98
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 85.45
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 85.39
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 85.36
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 84.96
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 84.89
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 84.83
2jrf_A184 Tubulin polymerization-promoting protein family me 83.7
1wlm_A151 Protein CGI-38; structural genomics, NPPSFA, natio 83.29
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 83.29
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 83.24
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 83.01
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 82.8
4fl4_A88 Glycoside hydrolase family 9; structural genomics, 82.53
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 81.02
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 80.92
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 80.63
>3ngq_A CCR4-NOT transcription complex subunit 6-like; alpha/beta sandwich fold, hydrolase; HET: 1PS; 1.80A {Homo sapiens} PDB: 3ngo_A 3ngn_A Back     alignment and structure
Probab=100.00  E-value=1.9e-34  Score=290.10  Aligned_cols=252  Identities=18%  Similarity=0.293  Sum_probs=173.2

Q ss_pred             CCcEEEEeeccccccccCCcccCccccCCCCCCChHhHHHHHHHHHhhCCCcEEEecc------------ccccCCccEE
Q 013124           44 ECCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQE------------RLGNAGYNTF  111 (449)
Q Consensus        44 ~~~lrv~TyNIl~~~y~~~~~~~~~~~~~~~~~~w~~R~~~i~~~I~~~~pDIIcLQE------------~l~~~gY~~~  111 (449)
                      ..+||||||||+++.|.+... ++||  +.....|.+|++.|+++|..++||||||||            .|...||.++
T Consensus        29 ~~~~~V~syNIl~d~~~~~~~-~~~~--p~~~~~W~~R~~~i~~~i~~~~pDIi~lQEv~~~q~~~~l~~~L~~~gY~~v  105 (398)
T 3ngq_A           29 SASFTVMCYNVLCDKYATRQL-YGYC--PSWALNWEYRKKGIMEEIVNCDADIISLQEVETEQYFTLFLPALKERGYDGF  105 (398)
T ss_dssp             CEEEEEEEEECCCGGGCCTTT-CTTS--CHHHHSHHHHHHHHHHHHHHHCCSEEEEEEEEHHHHHHTHHHHHHHTTEEEE
T ss_pred             CCCEEEEEEccCcCcCCcccc-ccCC--ChhhcCHHHHHHHHHHHHHhcCCCEEEEecccHHHHHHHHHHHHHhCCceEE
Confidence            357999999999999988654 3566  235689999999999999999999999999            3556799998


Q ss_pred             EeccCC---------CCCCeEEEEEecCCceEeeeeEEEecccc-----------------CceeeEEeeeeecccccc-
Q 013124          112 SLARTN---------NRGDGLLTALHRDYFNVLNYRELLFNDFG-----------------DRVAQLVHVESVVPFFQN-  164 (449)
Q Consensus       112 ~~~~~~---------~~~~G~ai~~r~~~f~i~~~~~~~~~~~~-----------------~rv~~~~~~~~~~~~~~~-  164 (449)
                      |..++.         ..++|||||||+++|++++...++|++.+                 ++++.++.++.+...... 
T Consensus       106 ~~~k~r~~~~~~~~~~~~eG~AIfyr~~~f~ll~~~~i~ls~~~~~~s~~~~~~~~Ri~t~~nval~~~L~~~~~~~~~~  185 (398)
T 3ngq_A          106 FSPKSRAKIMSEQERKHVDGCAIFFKTEKFTLVQKHTVEFNQVAMANSDGSEAMLNRVMTKDNIGVAVVLEVHKELFGAG  185 (398)
T ss_dssp             EEESCTTSCCCHHHHHTCEEEEEEEETTTEEEEEEEEEEHHHHHHHTCTTCHHHHHTTTTCCCEEEEEEEEECGGGC---
T ss_pred             EecCCCccccccccccCcceeEEEEECCcceEEeeeEEecCCCcccccccchhhhcceeeccceeEEEEEEEcccccccc
Confidence            875432         35799999999999999999999997643                 446666656553211100 


Q ss_pred             ----cCCCCceEEEEEeeecCCCCCCchhHHHHHHHHHHHHHHHHHHhcc---------CCCCCEEEeecCCCCCCccch
Q 013124          165 ----QGGGQQEILIVNTHLLFPHDSSLSVVRLHQVYKILQYLELYQTENK---------LNHIPIILCGDWNGSKRGHVY  231 (449)
Q Consensus       165 ----~~~~g~~v~v~ntHL~~~~~~~~~~~R~~Q~~~l~~~l~~~~~~~~---------~~~~pvIl~GDFN~~p~s~~~  231 (449)
                          +...++.|+|+||||.|.|  ...++|+.|+..|++.++++.++..         ....|+|||||||+.|++.+|
T Consensus       186 ~~~~~~~~~~~l~V~nTHL~~~p--~~~~vRl~Q~~~Ll~~l~~~~~~~~~~~~~~~~~~~~~PvIl~GDFNs~P~s~vy  263 (398)
T 3ngq_A          186 MKPIHAADKQLLIVANAHMHWDP--EYSDVKLIQTMMFVSEVKNILEKASSRPGSPTADPNSIPLVLCADLNSLPDSGVV  263 (398)
T ss_dssp             --------CCEEEEEEEECCCCT--TCHHHHHHHHHHHHHHHHHHHCC-------------CCCEEEEEECSCCTTSHHH
T ss_pred             cccccCCCCcEEEEEEeCcCCCC--CCHHHHHHHHHHHHHHHHHHHHHhhcccccccccCCCCceEEEeeCCCCCCCHHH
Confidence                1125788999999999966  5679999999999999999864321         146799999999999999999


Q ss_pred             hhhhcCCCcccc-cccc--cCCCCCcCcCcccccCCCCCCc-cccccc-cccCCCCCCCchhhhhHHHHHHHHHHHhhh
Q 013124          232 KFLRSQGFVSSY-DVAH--QYTDGDADAHKWVSHRNHRGNI-CGVDFI-WLRNPNQSRKPLQASWAEAVFSIIKCQLQK  305 (449)
Q Consensus       232 ~~L~~~g~~~~~-~~~~--~~~~~~~~~~~w~s~~~~~~~~-~~vD~i-~l~~ps~~~~p~~ts~~~a~~~~id~ll~~  305 (449)
                      ++|+ .|.++.- ....  .|...   -..|..... .+.. ..+.|- -+.++....+++||+|+..|.+++||++..
T Consensus       264 ~~L~-~G~v~~~h~d~~~~~y~~~---~~~~~~~~~-~~~~~~~~~h~~~L~SAy~~~~~~fTnyt~~F~g~lDYI~~s  337 (398)
T 3ngq_A          264 EYLS-NGGVADNHKDFKELRYNEC---LMNFSCNGK-NGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKGVIDYIFYS  337 (398)
T ss_dssp             HHHH-HTEEETTCGGGCC-----G---GGGGCC--------CCEEECSCCEEETTTTTSSSCSEECSSCEECCEEEEEE
T ss_pred             HHHh-cCCCCCCChhhhhcccccc---ccccccccc-ccccccccccCccccccccCCCCCceeccCCcCCceeEEEEe
Confidence            9994 4665421 1111  01000   000000000 0000 001111 122223345899999999999999999954



>3l1w_A Uncharacterized protein; APC29019.2, conserved protein, enterococcus faecalis V583, PSI-2, MCSG, structural genomics; 1.60A {Enterococcus faecalis} Back     alignment and structure
>3g6s_A Putative endonuclease/exonuclease/phosphatase family protein; alpha-beta protein, structural genomics, PSI-2; 2.50A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3mpr_A Putative endonuclease/exonuclease/phosphatase FAM protein; structural genomics, PSI-2, protein structure initiative; HET: MSE PEG; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>4f1h_A Tyrosyl-DNA phosphodiesterase 2; hydrolase-DNA complex; HET: DNA; 1.66A {Danio rerio} PDB: 4fpv_A* 4f1h_B* Back     alignment and structure
>4gew_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; 2.35A {Caenorhabditis elegans} PDB: 4f1i_A Back     alignment and structure
>4gz1_A Tyrosyl-DNA phosphodiesterase 2; protein-DNA complex, DNA repair, 5'-DNA END processing, endonuclease/exonuclease/phosphatase domain; HET: DNA EPE; 1.50A {Mus musculus} PDB: 4gyz_A* 4gz0_A* 4gz2_A* Back     alignment and structure
>4fva_A 5'-tyrosyl-DNA phosphodiesterase; 5'-phosphotyrosyl-DNA diesterase, hydrolase; HET: EDO; 2.07A {Caenorhabditis elegans} Back     alignment and structure
>3teb_A Endonuclease/exonuclease/phosphatase; PSI-biology, MCSG, midwest center for structural genomics; 2.99A {Leptotrichia buccalis c-1013-b} Back     alignment and structure
>3i41_A Beta-hemolysin; beta toxin, sphingomyelinase, toxin; 1.75A {Staphylococcus aureus} PDB: 3i46_A 3i48_A 3i5v_A* 3k55_A Back     alignment and structure
>1zwx_A SMCL, sphingomyelinase-C; dnase1-like fold, beta-hairpin, hydrolase; 1.90A {Listeria ivanovii} SCOP: d.151.1.3 Back     alignment and structure
>1ako_A Exonuclease III; AP-endonuclease, DNA repair; 1.70A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>2jc4_A Exodeoxyribonuclease III; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: 1PE; 1.90A {Neisseria meningitidis} Back     alignment and structure
>2ddr_A Sphingomyelin phosphodiesterase; DNAse I like folding, riken structural genomics/proteomics initiative, RSGI, structural genomics, hydrolase; 1.40A {Bacillus cereus} SCOP: d.151.1.3 PDB: 2dds_A 2ddt_A* 2uyr_X Back     alignment and structure
>3g91_A MTH0212, exodeoxyribonuclease; double-strand specific 3'-5' exonuclease, AP endonuclease; HET: PG4; 1.23A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fzi_A 3g0a_A 3g1k_A 3g2c_A 3g3c_A* 3g3y_A* 3g4t_A* 3g00_A 3g0r_A* 3g2d_A* 3g38_A 3g8v_A* 3ga6_A Back     alignment and structure
>1vyb_A ORF2 contains A reverse transcriptase domain; endonuclease, APE-1 type, retrotransposition, retrotransposon, transferase; 1.8A {Homo sapiens} SCOP: d.151.1.1 PDB: 2v0s_A 2v0r_A Back     alignment and structure
>2jc5_A Exodeoxyribonuclease; hydrolase, repair phosphodiesterase, DNA repair, exonuclease, endonuclease; HET: BCN DIO GOL; 1.50A {Neisseria meningitidis} Back     alignment and structure
>2o3h_A DNA-(apurinic or apyrimidinic site) lyase; APE, endonuclease; 1.90A {Homo sapiens} PDB: 1bix_A 1dew_A* 1de8_B* 1de9_A* 2o3c_A Back     alignment and structure
>2voa_A AF_EXO, XTHA, exodeoxyribonuclease III; EXOIII, AP endonuclease, lyase; 1.7A {Archaeoglobus fulgidus} Back     alignment and structure
>1hd7_A DNA-(apurinic or apyrimidinic site) lyase; DNA repair, endonuclease, APE1, HAP1, REF-1; 1.95A {Homo sapiens} SCOP: d.151.1.1 PDB: 1e9n_A 3u8u_A 2isi_A Back     alignment and structure
>2j63_A AP-endonuclease; base excision repair, lyase; 2.48A {Leishmania major} Back     alignment and structure
>1wdu_A TRAS1 ORF2P; four-layered alpha/beta sandwich, RNA binding protein; 2.40A {Bombyx mori} SCOP: d.151.1.1 Back     alignment and structure
>2a40_B Deoxyribonuclease-1; WAVE, WH2, WAsp, actin, DNAse I, ARP2/3, structural protein; HET: HIC NAG ATP; 1.80A {Bos taurus} SCOP: d.151.1.1 PDB: 1dnk_A* 2a3z_B* 2a41_B* 2a42_B* 2d1k_B* 2dnj_A* 3cjc_D* 3dni_A* 1atn_D* Back     alignment and structure
>2ei9_A Non-LTR retrotransposon R1BMKS ORF2 protein; four layered alpha beta sandwich, gene regulation; 2.00A {Bombyx mori} Back     alignment and structure
>1sr4_B CDT B, cytolethal distending toxin protein B; bacterial, virulence, DNA damage, genotoxin, cytotoxins, cell cycle, apoptosis, lectin; 2.00A {Haemophilus ducreyi} SCOP: d.151.1.1 PDB: 2f2f_B Back     alignment and structure
>2f1n_A CDT B, cytolethal distending toxin subunit B; E.coli, DNAse I, microbatch; 1.73A {Escherichia coli} SCOP: d.151.1.1 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>2imq_X Salivary nitrophorin; ferrous heme, beta-sandwich, transport protein; HET: HEM; 1.30A {Cimex lectularius} SCOP: d.151.1.2 PDB: 1ntf_A* 1y21_A* 1yjh_A* 1si6_X* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1i9z_A Synaptojanin, phosphatidylinositol phosphate phosphatase; spsynaptojanin, IPP5C, IP3, IP2,, hydrolase; HET: 2IP; 1.80A {Schizosaccharomyces pombe} SCOP: d.151.1.2 PDB: 1i9y_A* Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2xsw_A 72 kDa inositol polyphosphate 5-phosphatase; inositol signalling, SGC stockholm, structural genomics CONS hydrolase; 1.90A {Homo sapiens} Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3mtc_A Type II inositol-1,4,5-trisphosphate 5-phosphatas; INPP5BA,phosphoinositide 5-phosphatase, inositol signalling, phosphatase, magnesium; HET: PIF; 2.40A {Homo sapiens} PDB: 3n9v_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>4a9c_A Phosphatidylinositol-3,4,5-trisphosphate 5-phosph; SGC, signalling, structural genomics consortium stockholm, magnesium binding, hydrolase; HET: B5F; 2.10A {Homo sapiens} PDB: 3nr8_B* Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>1pul_A Hypothetical protein C32E8.3 in chromosome I; alpha helical, northeast structural genomics consortium, PSI, protein structure initiative; NMR {Caenorhabditis elegans} SCOP: a.39.1.11 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>2jrf_A Tubulin polymerization-promoting protein family member 3; solution structure, structural genomics, PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wlm_A Protein CGI-38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.39.1.11 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>4fl4_A Glycoside hydrolase family 9; structural genomics, montreal-kingston bacterial structural initiative, BSGI, dockerin; 2.80A {Clostridium thermocellum} PDB: 3p0d_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 449
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-08
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-08
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 3e-08
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 4e-08
d1ksoa_93 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 5e-08
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 5e-08
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 5e-08
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 0.003
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 6e-08
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 3e-07
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 3e-07
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.001
d1wrka182 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens) 3e-07
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 4e-07
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 5e-07
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 5e-07
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 6e-07
d1qx2a_76 a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [Tax 1e-06
d1zfsa193 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus no 2e-06
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 2e-06
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 2e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-06
d1psra_100 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 2e-06
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 3e-06
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 3e-06
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 6e-06
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 7e-06
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 7e-06
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 7e-06
d1k8ua_89 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 9e-06
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-05
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 2e-05
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-05
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 2e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-05
d1xk4a187 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sa 5e-05
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 6e-05
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 9e-05
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 2e-04
d1zwxa1293 d.151.1.3 (A:41-333) Sphingomyelin phosphodiestera 2e-04
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 3e-04
d1w7jb1139 a.39.1.5 (B:11-149) Myosin Essential Chain {Human 3e-04
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-04
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 5e-04
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 7e-04
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 8e-04
d1m45a_146 a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's ye 0.001
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 0.002
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 0.002
d1wdcc_152 a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop 0.003
d1jfja_134 a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histoly 0.003
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 0.003
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 0.004
d2jxca195 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [ 0.004
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Caltractin (centrin 2)
species: Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]
 Score = 49.5 bits (118), Expect = 1e-08
 Identities = 17/65 (26%), Positives = 31/65 (47%), Gaps = 6/65 (9%)

Query: 312 DAFAFFKADNNGDVITHSAFCEALRQVNLAGLPYGLSFQETDDLWAQADVDGNGVVNYEE 371
            AF  F  DN+G  IT        ++     L   L+ +E  ++ A+AD + +  ++ +E
Sbjct: 13  KAFRLFDDDNSG-TITIKDLRRVAKE-----LGENLTEEELQEMIAEADRNDDNEIDEDE 66

Query: 372 FKQRM 376
           F + M
Sbjct: 67  FIRIM 71


>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Length = 76 Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Length = 293 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 152 Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Length = 134 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query449
d1zwxa1293 Sphingomyelin phosphodiesterase C {Listeria ivanov 99.84
d2ddra1299 Sphingomyelin phosphodiesterase C {Bacillus cereus 99.77
d1vyba_236 Endonuclease domain of LINE-1 reverse transcriptas 99.74
d2a40b1260 Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913 99.67
d1sr4b_261 Cytolethal distending toxin subunit B {Haemophilus 99.61
d1wdua_228 Endonuclease domain of TRAS1 retrotransposon (ORF2 99.57
d2f1na1250 Cytolethal distending toxin subunit B {Escherichia 99.57
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.43
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.42
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 99.4
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 99.39
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.38
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 99.37
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 99.37
d1hd7a_275 DNA repair endonuclease Hap1 {Human (Homo sapiens) 99.36
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.36
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 99.36
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 99.36
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 99.35
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.33
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 99.31
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.28
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 99.27
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.22
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.21
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.21
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.2
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 99.17
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 99.17
d1akoa_268 DNA-repair enzyme exonuclease III {Escherichia col 99.15
d2imqx1280 Salivary nitrophorin {Bedbug (Cimex lectularius) [ 99.11
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.09
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.08
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.08
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.06
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 99.05
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 99.05
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.05
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.03
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 99.02
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 99.02
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.01
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 99.01
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.0
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.0
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.98
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.98
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.98
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.97
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 98.95
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.94
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.92
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.91
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.91
d1i9za_345 Synaptojanin, IPP5C domain {Fission yeast (Schizos 98.89
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.86
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.86
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.86
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.86
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 98.86
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.84
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.84
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 98.82
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 98.81
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.78
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.78
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 98.78
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.78
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.76
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.75
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 98.74
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 98.74
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 98.7
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.69
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.68
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.66
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 98.65
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 98.64
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.64
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 98.62
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 98.61
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 98.59
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 98.59
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 98.59
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.59
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.58
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 98.56
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 98.54
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 98.54
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.5
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 98.48
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 98.45
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.45
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 98.44
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 98.44
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.43
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.42
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.41
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.39
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 98.37
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 98.36
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 98.34
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.32
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.27
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 98.25
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.14
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 98.12
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 98.09
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 98.08
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 98.06
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.98
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 97.78
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 97.75
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 97.72
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 97.61
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 97.39
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 97.38
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.37
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 97.33
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 97.33
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 97.25
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 97.17
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.17
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 97.13
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 96.97
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 96.84
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 96.81
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.7
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.45
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 96.35
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.29
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 96.15
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.01
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.85
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 95.8
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.57
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 95.45
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.14
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 95.08
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.05
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 94.85
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 94.66
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 94.57
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.12
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.1
d1h8ba_73 alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} 93.92
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 93.82
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 93.34
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 93.17
d1qasa194 Phosphoinositide-specific phospholipase C, isozyme 92.83
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 91.37
d1j7qa_86 Calcium vector protein {Amphioxus (Branchiostoma l 91.11
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 90.11
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 89.4
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 88.76
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 87.98
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 87.87
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 85.79
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 85.5
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 83.61
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 83.49
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 83.2
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 81.79
d1pula1103 Hypothetical protein c32e8.3 {Caenorhabditis elega 81.45
d2cclb159 Endo-1,4-beta-xylanase Y {Clostridium thermocellum 81.25
>d1zwxa1 d.151.1.3 (A:41-333) Sphingomyelin phosphodiesterase C {Listeria ivanovii [TaxId: 1638]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: DNase I-like
superfamily: DNase I-like
family: Sphingomyelin phosphodiesterase-like
domain: Sphingomyelin phosphodiesterase C
species: Listeria ivanovii [TaxId: 1638]
Probab=99.84  E-value=3.3e-20  Score=175.12  Aligned_cols=210  Identities=15%  Similarity=0.147  Sum_probs=122.1

Q ss_pred             CcEEEEeeccccccccCCcccCccccCCCCCCChHhHHHHHHHHHhhCCCcEEEecc---------cccc--CCccEEEe
Q 013124           45 CCISCTTFNILAPIYKRLDHQNQSLRESDVRDSWFNRNQTILDWLICERSSVICLQE---------RLGN--AGYNTFSL  113 (449)
Q Consensus        45 ~~lrv~TyNIl~~~y~~~~~~~~~~~~~~~~~~w~~R~~~i~~~I~~~~pDIIcLQE---------~l~~--~gY~~~~~  113 (449)
                      +.||||||||+..  .. ..        .....+..|.++|.+.|..++||||||||         .+..  ..|...+.
T Consensus         3 ~~lki~s~Nv~~~--~~-~~--------~~~~~~~~r~~~i~~~i~~~~~DVi~LQEv~~~~~~~~l~~~~~~~~~~~~~   71 (293)
T d1zwxa1           3 GNFKITSHNVYLF--SR-NI--------YPNWGQMHRADLIAQADYMKNNDVVILNEAFDTSASHRLLNNLREMYPHQTP   71 (293)
T ss_dssp             CSCEEEEEEEEEC--CT-TT--------STTSCHHHHHHHHHTSGGGSSCSEEEEEEECSHHHHHHHHHHTTTTCCEECC
T ss_pred             CCCEEEEEecCcC--cc-cc--------CCCcCHHHHHHHHHHHHHhcCCCEEEEEccCCcchHHHHHHHHhhhccceeh
Confidence            5799999999752  11 11        11234677899999999999999999999         1111  12322211


Q ss_pred             c----------------cCCCCCCeEEEEEecCCceEeeeeEEEeccccC------ceeeEEeeeeecccccccCCCCce
Q 013124          114 A----------------RTNNRGDGLLTALHRDYFNVLNYRELLFNDFGD------RVAQLVHVESVVPFFQNQGGGQQE  171 (449)
Q Consensus       114 ~----------------~~~~~~~G~ai~~r~~~f~i~~~~~~~~~~~~~------rv~~~~~~~~~~~~~~~~~~~g~~  171 (449)
                      .                .......|++|+   +++++.....+.+.....      +....+....          .+..
T Consensus        72 ~~~~~~~~~~~~~~~~~~~~~~~~g~~il---sr~pi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~  138 (293)
T d1zwxa1          72 VIGRSKHGWDKTEGNYSNFALEDGGVAVV---SQWPIVEKSQHIFQRGGGADRLSNKGFAYVKIMK----------NGKP  138 (293)
T ss_dssp             CTTSCSTTCSEEEC-----CCBCCCCEEE---ESSCEEEEEEEECSCCCGGGGGBCCEEEEEEEEE----------TTEE
T ss_pred             hcccccccccccccccccccccccceEEE---eccCcccceeeeeeccccccccccceEEEEEEec----------CCce
Confidence            1                111224689999   566887776665443321      1111111222          6789


Q ss_pred             EEEEEeeecCCCCCC----chhHHHHHHHHHHHHHHHHHHhccCCCCCEEEeecCCCCCCccchhhhhcC-CCccccccc
Q 013124          172 ILIVNTHLLFPHDSS----LSVVRLHQVYKILQYLELYQTENKLNHIPIILCGDWNGSKRGHVYKFLRSQ-GFVSSYDVA  246 (449)
Q Consensus       172 v~v~ntHL~~~~~~~----~~~~R~~Q~~~l~~~l~~~~~~~~~~~~pvIl~GDFN~~p~s~~~~~L~~~-g~~~~~~~~  246 (449)
                      ++|+|+||.+.....    ....|..|+..++..+.....   ..+.|+|||||||..|.+..++.|+.. ++.......
T Consensus       139 ~~v~~~Hl~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~~---~~~~~vil~GDfN~~~~~~~~~~~~~~~~~~~~~~~~  215 (293)
T d1zwxa1         139 YHIIGTHTQADDSLISKDTSRAIRAEQMQEIQTFIAKKNI---PKDEIIFIGGDLNVNYGTDEYHDMLKLLNVSSPANFN  215 (293)
T ss_dssp             EEEEEEECCCCCTTSCHHHHHHHHHHHHHHHHHHHHHHTC---CTTSEEEEEEECCCCTTSHHHHHHHHHHTBCCCTTCC
T ss_pred             EEEEEeeeeccCCccchhHHHHHHHHHHHHhhhhhhhhcc---CCCCcEEEEeecCCCCCchHHHHHHhhccccchhhcc
Confidence            999999997643221    124577888877777765432   246799999999999999999888654 322222111


Q ss_pred             ccCCCCCcCcCcccccCCCCCCccccccccccCCC
Q 013124          247 HQYTDGDADAHKWVSHRNHRGNICGVDFIWLRNPN  281 (449)
Q Consensus       247 ~~~~~~~~~~~~w~s~~~~~~~~~~vD~i~l~~ps  281 (449)
                      ......+.....+.......+...++||||++...
T Consensus       216 ~~~~~~~~~~~~~~~~~~~~~~~~~iD~I~~s~~~  250 (293)
T d1zwxa1         216 GQMATWDPTTNSMLKESYPKAAPEYLDYIFVENGH  250 (293)
T ss_dssp             TTSCSBCTTTCHHHHHHCTTSCCBCCEEEEEBTTS
T ss_pred             cCCcccccccccccccccCCCCCceEEEEEEeccc
Confidence            11111111111122222222344579999998763



>d2ddra1 d.151.1.3 (A:7-305) Sphingomyelin phosphodiesterase C {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1vyba_ d.151.1.1 (A:) Endonuclease domain of LINE-1 reverse transcriptase homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a40b1 d.151.1.1 (B:1-260) Deoxyribonuclease I {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sr4b_ d.151.1.1 (B:) Cytolethal distending toxin subunit B {Haemophilus ducreyi [TaxId: 730]} Back     information, alignment and structure
>d1wdua_ d.151.1.1 (A:) Endonuclease domain of TRAS1 retrotransposon (ORF2) {Silkworm (Bombyx mori) [TaxId: 7091]} Back     information, alignment and structure
>d2f1na1 d.151.1.1 (A:1-250) Cytolethal distending toxin subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hd7a_ d.151.1.1 (A:) DNA repair endonuclease Hap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1akoa_ d.151.1.1 (A:) DNA-repair enzyme exonuclease III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2imqx1 d.151.1.2 (X:3-282) Salivary nitrophorin {Bedbug (Cimex lectularius) [TaxId: 79782]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1i9za_ d.151.1.2 (A:) Synaptojanin, IPP5C domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1h8ba_ a.39.1.7 (A:) alpha-Actinin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qasa1 a.39.1.7 (A:205-298) Phosphoinositide-specific phospholipase C, isozyme D1 (PLC-D!) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j7qa_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1pula1 a.39.1.11 (A:18-120) Hypothetical protein c32e8.3 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2cclb1 a.139.1.1 (B:1-59) Endo-1,4-beta-xylanase Y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure