Citrus Sinensis ID: 013151


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHcHHHHHHcccccHHHHHHHHHcccccHHHHccccccccHHHHHHHHHHccccccccHHHHHHccccHHHHHHHHccccccccccccccccccHHcccccccccEEEECcccccccEEccccHHHHHHHHcccHHHHHHHHHccHHHHHHHHHccccccHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHcccc
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
xxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium channel SKOR Highly selective outward-rectifying potassium channel. Involved in potassium release into the xylem sap toward the shoots. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by depolarization. The voltage-dependence of the channel is abolished by internal or external acidification. May interact with the cytoskeleton or with regulatory proteins.probableQ9M8S6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 200-441
View the alignment between query and template
View the model in PyMOL
Template: 3TNP, chain B
Confidence level:very confident
Coverage over the Query: 76-208
View the alignment between query and template
View the model in PyMOL
Template: 1ORQ, chain C
Confidence level:probable
Coverage over the Query: 7-36,47-74
View the alignment between query and template
View the model in PyMOL