Citrus Sinensis ID: 013151


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
cccccccccccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHcHHHHHHcccccHHHHHHHHHcccccHHHHHcccccccHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHccccccccccccccccccHHcccccccccEEEEEcccccccEEccccHHHHHHHHcccHHHHHHHHHccHHHHHHHHHccccccHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHcccc
ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccHHHHHHHHHcHHHHHHHHHHHHHHHHHHccEEcccccHHHHHHHHHHHHHHHcccccEEEEEccccccEEEEEcccHHHHHHHHcccHHHHHHHccccccccEEEEcccccccEHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccHHHHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHcccc
mefaffrglpenlsiLDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMpyiekvslfkgcsseFINQIVIRVHeefflpgevimEQGNVVDQLYFVCHGVleevgvgedgseetvsqlqpnssfgevsilcnipqpytVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVnsaayhgdlyqlkgliragadpnktdydgrsplhlatsrgyeDITLFLIQKgvdinikdkfgntplleaikcghDGVTSLLVKEgaslnvddagsFLCTAVARGDSDFLKRVLsngvdpssrdydhrtplhvAASEGLYLMAKLLLEAGAsvftkdrwgntpldegrmcgnKNLIKLLEDAEctqlsefhycSQGMIGIAENLLLLPLC
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNgvdpssrdydhrTPLHVAASEGLYLMAKLLLEAGASVFTKDRwgntpldegrmcGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFvchgvleevgvgedgseetvSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
**FAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVG****************FGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGAD****DYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNG********DHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLP**
MEFAFF*GLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVG************PNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
*EFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFAFFRGLPENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQLSEFHYCSQGMIGIAENLLLLPLC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query448 2.2.26 [Sep-21-2011]
Q9M8S6828 Potassium channel SKOR OS yes no 0.843 0.456 0.735 1e-167
Q94A76820 Potassium channel GORK OS no no 0.810 0.442 0.713 1e-158
Q653P0858 Potassium channel KOR1 OS yes no 0.843 0.440 0.661 1e-153
Q7XUW4719 Potassium channel KOR2 OS no no 0.812 0.506 0.583 1e-129
Q38998 857 Potassium channel AKT1 OS no no 0.794 0.415 0.320 6e-47
Q8GXE6 888 Potassium channel AKT6 OS no no 0.794 0.400 0.328 4e-46
Q9SCX5 880 Probable potassium channe no no 0.823 0.419 0.306 1e-45
P0C550 935 Potassium channel AKT1 OS N/A no 0.852 0.408 0.303 2e-45
Q0JKV1 935 Potassium channel AKT1 OS no no 0.852 0.408 0.303 2e-45
Q8H569 907 Potassium channel AKT3 OS no no 0.783 0.386 0.309 5e-40
>sp|Q9M8S6|SKOR_ARATH Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 Back     alignment and function desciption
 Score =  590 bits (1520), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 278/378 (73%), Positives = 330/378 (87%)

Query: 51  IALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEF 110
           + L+Y  S     +L  +P  +  KI+QTLY+PYIEKV LF+GCSSEFINQIVIR+HEEF
Sbjct: 364 LRLQYESSYTEAAVLQDIPVSIRAKIAQTLYLPYIEKVPLFRGCSSEFINQIVIRLHEEF 423

Query: 111 FLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQP 170
           FLPGEVIMEQG+VVDQLYFVCHGVLEE+G+ +DGSEE V+ LQP+ SFGE+SILCNIPQP
Sbjct: 424 FLPGEVIMEQGSVVDQLYFVCHGVLEEIGITKDGSEEIVAVLQPDHSFGEISILCNIPQP 483

Query: 171 YTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGK 230
           YTV + EL R+LR+DKQSF NILEI+F DGR++L NLLEGKESN+R+KQL+SDITFHI K
Sbjct: 484 YTVRVAELCRILRLDKQSFMNILEIFFHDGRRILNNLLEGKESNVRIKQLESDITFHISK 543

Query: 231 HEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQK 290
            EAELAL++NSAA++GDLYQLK LIRAG DPNKTDYDGRSPLHLA SRGYEDITL+LIQ+
Sbjct: 544 QEAELALKLNSAAFYGDLYQLKSLIRAGGDPNKTDYDGRSPLHLAASRGYEDITLYLIQE 603

Query: 291 GVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKR 350
            VD+NIKDK G+TPLLEAIK G+D V +LLVKEGA+LN+++AG+FLCT VA+GDSDFLKR
Sbjct: 604 SVDVNIKDKLGSTPLLEAIKNGNDRVAALLVKEGATLNIENAGTFLCTVVAKGDSDFLKR 663

Query: 351 VLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGN 410
           +LSNG+DP+S+DYDHRTPLHVAASEG Y++A  L+EA A+V  KDRWGNTPLDE   CGN
Sbjct: 664 LLSNGIDPNSKDYDHRTPLHVAASEGFYVLAIQLVEASANVLAKDRWGNTPLDEALGCGN 723

Query: 411 KNLIKLLEDAECTQLSEF 428
           K LIKLLEDA+ +Q+S F
Sbjct: 724 KMLIKLLEDAKNSQISSF 741




Highly selective outward-rectifying potassium channel. Involved in potassium release into the xylem sap toward the shoots. Assuming opened or closed conformations in response to the voltage difference across the membrane, the channel is activated by depolarization. The voltage-dependence of the channel is abolished by internal or external acidification. May interact with the cytoskeleton or with regulatory proteins.
Arabidopsis thaliana (taxid: 3702)
>sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 Back     alignment and function description
>sp|Q653P0|KOR1_ORYSJ Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 Back     alignment and function description
>sp|Q7XUW4|KOR2_ORYSJ Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 Back     alignment and function description
>sp|Q38998|AKT1_ARATH Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 Back     alignment and function description
>sp|Q8GXE6|AKT6_ARATH Potassium channel AKT6 OS=Arabidopsis thaliana GN=AKT6 PE=1 SV=2 Back     alignment and function description
>sp|Q9SCX5|AKT5_ARATH Probable potassium channel AKT5 OS=Arabidopsis thaliana GN=AKT5 PE=2 SV=2 Back     alignment and function description
>sp|P0C550|AKT1_ORYSI Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 Back     alignment and function description
>sp|Q0JKV1|AKT1_ORYSJ Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 Back     alignment and function description
>sp|Q8H569|AKT3_ORYSJ Potassium channel AKT3 OS=Oryza sativa subsp. japonica GN=Os07g0175400 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
224065090 841 predicted protein [Populus trichocarpa] 0.854 0.455 0.817 0.0
224079588 821 predicted protein [Populus trichocarpa] 0.823 0.449 0.829 1e-179
356552003 850 PREDICTED: potassium channel SKOR-like [ 0.841 0.443 0.804 1e-179
356499077 849 PREDICTED: potassium channel SKOR-like [ 0.841 0.444 0.798 1e-178
147777957 559 hypothetical protein VITISV_022830 [Viti 0.837 0.670 0.786 1e-175
255585584445 Potassium channel SKOR, putative [Ricinu 0.790 0.795 0.830 1e-175
225451365 794 PREDICTED: potassium channel SKOR [Vitis 0.837 0.472 0.783 1e-174
449479935 828 PREDICTED: potassium channel SKOR-like [ 0.854 0.462 0.759 1e-174
449445216 828 PREDICTED: potassium channel SKOR-like [ 0.854 0.462 0.759 1e-174
15232991 828 Potassium channel SKOR [Arabidopsis thal 0.843 0.456 0.735 1e-166
>gi|224065090|ref|XP_002301665.1| predicted protein [Populus trichocarpa] gi|222843391|gb|EEE80938.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/383 (81%), Positives = 340/383 (88%)

Query: 51  IALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEF 110
           + L+Y  S      L  LP  +  K+SQTLY  YIEKV L KGCS+EFINQIVIR+HEEF
Sbjct: 373 VRLQYESSYTEASALQDLPISIRAKVSQTLYTEYIEKVPLLKGCSAEFINQIVIRLHEEF 432

Query: 111 FLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQP 170
           FLPGEVIMEQGNVVDQLYFVCHGVLEEVG+G+DGSEETV  L PNSSFGE+SILCNIPQP
Sbjct: 433 FLPGEVIMEQGNVVDQLYFVCHGVLEEVGIGQDGSEETVKLLPPNSSFGEISILCNIPQP 492

Query: 171 YTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGK 230
           YTV +CEL RLLRIDKQSF+NILEIYF DGRK+L NLLEGKESNLR KQL+SDITFHIGK
Sbjct: 493 YTVRVCELCRLLRIDKQSFSNILEIYFYDGRKILDNLLEGKESNLRDKQLESDITFHIGK 552

Query: 231 HEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQK 290
            EAELALRVNSAAYHGDLYQLKG IRAGADPN+TDYDGRSPLHLA SRGYEDITLFLIQ+
Sbjct: 553 QEAELALRVNSAAYHGDLYQLKGFIRAGADPNRTDYDGRSPLHLAASRGYEDITLFLIQE 612

Query: 291 GVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKR 350
           GVDINIKDKFGNTPLLEAIK GHD V SLL K+GA LN+DDAGS LC AVARGDSDFLKR
Sbjct: 613 GVDINIKDKFGNTPLLEAIKNGHDRVESLLFKQGAILNIDDAGSVLCRAVARGDSDFLKR 672

Query: 351 VLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGN 410
           +LSNG+DP+S+DYDHRTPLHVAASEGLYLMAKLL+EAGASVF+KDRWGNTPLDEGRMCGN
Sbjct: 673 ILSNGIDPNSKDYDHRTPLHVAASEGLYLMAKLLIEAGASVFSKDRWGNTPLDEGRMCGN 732

Query: 411 KNLIKLLEDAECTQLSEFHYCSQ 433
           K LIKLLE+A+ +Q  EFHY + 
Sbjct: 733 KKLIKLLEEAKSSQKLEFHYSTH 755




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224079588|ref|XP_002305894.1| predicted protein [Populus trichocarpa] gi|222848858|gb|EEE86405.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356552003|ref|XP_003544361.1| PREDICTED: potassium channel SKOR-like [Glycine max] Back     alignment and taxonomy information
>gi|356499077|ref|XP_003518370.1| PREDICTED: potassium channel SKOR-like [Glycine max] Back     alignment and taxonomy information
>gi|147777957|emb|CAN64951.1| hypothetical protein VITISV_022830 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255585584|ref|XP_002533481.1| Potassium channel SKOR, putative [Ricinus communis] gi|223526674|gb|EEF28913.1| Potassium channel SKOR, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|225451365|ref|XP_002262949.1| PREDICTED: potassium channel SKOR [Vitis vinifera] gi|296087079|emb|CBI33453.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449479935|ref|XP_004155751.1| PREDICTED: potassium channel SKOR-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449445216|ref|XP_004140369.1| PREDICTED: potassium channel SKOR-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|15232991|ref|NP_186934.1| Potassium channel SKOR [Arabidopsis thaliana] gi|44888539|sp|Q9M8S6.1|SKOR_ARATH RecName: Full=Potassium channel SKOR; AltName: Full=Stelar K(+) outward rectifying channel gi|6728977|gb|AAF26975.1|AC018363_20 stelar K+ outward rectifying channel (SKOR) [Arabidopsis thaliana] gi|332640345|gb|AEE73866.1| Potassium channel SKOR [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query448
TAIR|locus:2075442828 SKOR "STELAR K+ outward rectif 0.843 0.456 0.695 8.8e-171
TAIR|locus:2169866820 GORK "gated outwardly-rectifyi 0.810 0.442 0.683 9.3e-165
TAIR|locus:2043839 857 KT1 "AT2G26650" [Arabidopsis t 0.828 0.432 0.299 9.3e-54
TAIR|locus:2127866 880 KT5 "K+ transporter 5" [Arabid 0.785 0.4 0.312 1.3e-50
TAIR|locus:2132065802 KT2/3 "potassium transport 2/3 0.803 0.448 0.307 7.9e-47
TAIR|locus:2005531697 KAT2 "potassium channel in Ara 0.334 0.215 0.305 5.1e-21
ZFIN|ZDB-GENE-050112-1226 psmd10 "proteasome (prosome, m 0.410 0.814 0.354 5e-20
UNIPROTKB|O75832226 PSMD10 "26S proteasome non-ATP 0.397 0.787 0.362 6.5e-19
ZFIN|ZDB-GENE-041210-88280 asb13a.2 "ankyrin repeat and S 0.397 0.635 0.335 1.4e-18
ZFIN|ZDB-GENE-050522-247 1071 ankrd52a "ankyrin repeat domai 0.399 0.167 0.318 1.6e-18
TAIR|locus:2075442 SKOR "STELAR K+ outward rectifier" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1367 (486.3 bits), Expect = 8.8e-171, Sum P(2) = 8.8e-171
 Identities = 263/378 (69%), Positives = 312/378 (82%)

Query:    51 IALRYLKSSFIIDLLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEF 110
             + L+Y  S     +L  +P  +  KI+QTLY+PYIEKV LF+GCSSEFINQIVIR+HEEF
Sbjct:   364 LRLQYESSYTEAAVLQDIPVSIRAKIAQTLYLPYIEKVPLFRGCSSEFINQIVIRLHEEF 423

Query:   111 FLPGEVIMEQGNVVDQLYFXXXXXXXXXXXXXXXXXXXXSQLQPNSSFGEVSILCNIPQP 170
             FLPGEVIMEQG+VVDQLYF                    + LQP+ SFGE+SILCNIPQP
Sbjct:   424 FLPGEVIMEQGSVVDQLYFVCHGVLEEIGITKDGSEEIVAVLQPDHSFGEISILCNIPQP 483

Query:   171 YTVCICELSRLLRIDKQSFTNILEIYFCDGRKVLTNLLEGKESNLRLKQLKSDITFHIGK 230
             YTV + EL R+LR+DKQSF NILEI+F DGR++L NLLEGKESN+R+KQL+SDITFHI K
Sbjct:   484 YTVRVAELCRILRLDKQSFMNILEIFFHDGRRILNNLLEGKESNVRIKQLESDITFHISK 543

Query:   231 HEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQK 290
              EAELAL++NSAA++GDLYQLK LIRAG DPNKTDYDGRSPLHLA SRGYEDITL+LIQ+
Sbjct:   544 QEAELALKLNSAAFYGDLYQLKSLIRAGGDPNKTDYDGRSPLHLAASRGYEDITLYLIQE 603

Query:   291 GVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKR 350
              VD+NIKDK G+TPLLEAIK G+D V +LLVKEGA+LN+++AG+FLCT VA+GDSDFLKR
Sbjct:   604 SVDVNIKDKLGSTPLLEAIKNGNDRVAALLVKEGATLNIENAGTFLCTVVAKGDSDFLKR 663

Query:   351 VLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGN 410
             +LSNG+DP+S+DYDHRTPLHVAASEG Y++A  L+EA A+V  KDRWGNTPLDE   CGN
Sbjct:   664 LLSNGIDPNSKDYDHRTPLHVAASEGFYVLAIQLVEASANVLAKDRWGNTPLDEALGCGN 723

Query:   411 KNLIKLLEDAECTQLSEF 428
             K LIKLLEDA+ +Q+S F
Sbjct:   724 KMLIKLLEDAKNSQISSF 741


GO:0005216 "ion channel activity" evidence=IEA
GO:0005249 "voltage-gated potassium channel activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006811 "ion transport" evidence=IEA
GO:0006813 "potassium ion transport" evidence=IEA;IMP;IDA
GO:0016020 "membrane" evidence=IEA
GO:0030551 "cyclic nucleotide binding" evidence=ISS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0010200 "response to chitin" evidence=RCA
GO:0050832 "defense response to fungus" evidence=RCA
GO:0005242 "inward rectifier potassium channel activity" evidence=IDA
GO:0009737 "response to abscisic acid stimulus" evidence=IEP
GO:0015271 "outward rectifier potassium channel activity" evidence=IDA
TAIR|locus:2169866 GORK "gated outwardly-rectifying K+ channel" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043839 KT1 "AT2G26650" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2127866 KT5 "K+ transporter 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2132065 KT2/3 "potassium transport 2/3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2005531 KAT2 "potassium channel in Arabidopsis thaliana 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050112-1 psmd10 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 10" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O75832 PSMD10 "26S proteasome non-ATPase regulatory subunit 10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041210-88 asb13a.2 "ankyrin repeat and SOCS box-containing 13a, tandem duplicate 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-247 ankrd52a "ankyrin repeat domain 52a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9M8S6SKOR_ARATHNo assigned EC number0.73540.84370.4565yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-51
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-33
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-27
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 2e-24
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-20
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-19
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 3e-17
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 2e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-16
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-15
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 9e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-14
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 4e-14
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-14
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-13
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-13
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 8e-13
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-11
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 1e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-10
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-10
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 3e-09
PHA02946 446 PHA02946, PHA02946, ankyin-like protein; Provision 4e-09
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 6e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 6e-09
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 7e-09
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-08
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-08
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 2e-08
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-08
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-07
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-07
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 6e-06
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-06
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 1e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 2e-04
smart0024830 smart00248, ANK, ankyrin repeats 2e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 2e-04
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 4e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-04
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 0.001
PHA02917661 PHA02917, PHA02917, ankyrin-like protein; Provisio 0.001
PHA02736154 PHA02736, PHA02736, Viral ankyrin protein; Provisi 0.001
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.002
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 0.002
TIGR03896317 TIGR03896, cyc_nuc_ocin, bacteriocin-type transpor 0.002
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.003
smart0024830 smart00248, ANK, ankyrin repeats 0.004
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
 Score =  185 bits (472), Expect = 2e-51
 Identities = 110/332 (33%), Positives = 168/332 (50%), Gaps = 9/332 (2%)

Query: 64  LLSCLPWDVIYKISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEEFFLPGEVIMEQGNV 123
           L+  LP  +   I Q L++P +EKV LFKG S E +  +V ++  E+  P E ++ Q   
Sbjct: 355 LIDQLPKSICKSICQHLFLPVVEKVYLFKGVSREILLLLVTKMKAEYIPPREDVIMQNEA 414

Query: 124 VDQLYFVCHGVLEEVGV-GEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLL 182
            D +Y V  G +E +   GE   E  V  L     FGEV  LC  PQ +T     LS+LL
Sbjct: 415 PDDVYIVVSGEVEIIDSEGEK--ERVVGTLGCGDIFGEVGALCCRPQSFTFRTKTLSQLL 472

Query: 183 RIDKQSFTNILEIYFCDGRKVLTNLLEG--KESNLRLKQLKSDITFHIGKH-EAELALRV 239
           R+   +    ++    D   +L N L+   +  +L +  L  D   + G+H +  +A  +
Sbjct: 473 RLKTSTLIEAMQTRQEDNVVILKNFLQHHKELHDLNVGDLLGD---NGGEHDDPNMASNL 529

Query: 240 NSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDK 299
            + A  G+   L+ L++A  DP+  D  GR+PLH+A S+GYED  L L++   +++I+D 
Sbjct: 530 LTVASTGNAALLEELLKAKLDPDIGDSKGRTPLHIAASKGYEDCVLVLLKHACNVHIRDA 589

Query: 300 FGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVLSNGVDPS 359
            GNT L  AI   H  +  +L    +  +   AG  LCTA  R D   +K +L  G++  
Sbjct: 590 NGNTALWNAISAKHHKIFRILYHFASISDPHAAGDLLCTAAKRNDLTAMKELLKQGLNVD 649

Query: 360 SRDYDHRTPLHVAASEGLYLMAKLLLEAGASV 391
           S D+   T L VA +E    M +LL+  GA V
Sbjct: 650 SEDHQGATALQVAMAEDHVDMVRLLIMNGADV 681


Length = 823

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165103 PHA02736, PHA02736, Viral ankyrin protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|234384 TIGR03896, cyc_nuc_ocin, bacteriocin-type transport-associated protein Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 448
PLN03192823 Voltage-dependent potassium channel; Provisional 100.0
KOG0498727 consensus K+-channel ERG and related proteins, con 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
KOG4412226 consensus 26S proteasome regulatory complex, subun 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA02874 434 ankyrin repeat protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
KOG0509 600 consensus Ankyrin repeat and DHHC-type Zn-finger d 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02946 446 ankyin-like protein; Provisional 100.0
PHA02878 477 ankyrin repeat protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02859209 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02795 437 ankyrin-like protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 99.98
PHA02989 494 ankyrin repeat protein; Provisional 99.98
KOG0510 929 consensus Ankyrin repeat protein [General function 99.97
PHA02798 489 ankyrin-like protein; Provisional 99.97
KOG0510 929 consensus Ankyrin repeat protein [General function 99.97
KOG0508 615 consensus Ankyrin repeat protein [General function 99.97
PHA02917 661 ankyrin-like protein; Provisional 99.97
KOG0501971 consensus K+-channel KCNQ [Inorganic ion transport 99.97
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02730 672 ankyrin-like protein; Provisional 99.96
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.96
KOG0508 615 consensus Ankyrin repeat protein [General function 99.96
PHA02917 661 ankyrin-like protein; Provisional 99.96
PHA02730 672 ankyrin-like protein; Provisional 99.96
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.96
KOG0500536 consensus Cyclic nucleotide-gated cation channel C 99.96
KOG4177 1143 consensus Ankyrin [Cell wall/membrane/envelope bio 99.95
PHA02792 631 ankyrin-like protein; Provisional 99.95
PHA02795 437 ankyrin-like protein; Provisional 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.94
PHA02792 631 ankyrin-like protein; Provisional 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.94
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.93
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.92
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.92
KOG0514452 consensus Ankyrin repeat protein [General function 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.92
PHA02741169 hypothetical protein; Provisional 99.91
KOG0505 527 consensus Myosin phosphatase, regulatory subunit [ 99.91
KOG0502296 consensus Integral membrane ankyrin-repeat protein 99.91
KOG0507 854 consensus CASK-interacting adaptor protein (caskin 99.91
PHA02743166 Viral ankyrin protein; Provisional 99.9
PHA02884300 ankyrin repeat protein; Provisional 99.9
KOG0499815 consensus Cyclic nucleotide-gated cation channel C 99.9
PHA02884 300 ankyrin repeat protein; Provisional 99.89
PHA02736154 Viral ankyrin protein; Provisional 99.88
KOG0514452 consensus Ankyrin repeat protein [General function 99.88
PHA02741169 hypothetical protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.87
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.85
KOG0512228 consensus Fetal globin-inducing factor (contains a 99.84
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.84
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.84
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.83
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.8
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.79
KOG0195 448 consensus Integrin-linked kinase [Signal transduct 99.78
KOG4369 2131 consensus RTK signaling protein MASK/UNC-44 [Signa 99.78
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.77
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.75
KOG3676 782 consensus Ca2+-permeable cation channel OSM-9 and 99.74
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.68
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.65
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.65
KOG4214117 consensus Myotrophin and similar proteins [Transcr 99.63
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.62
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.6
cd00038115 CAP_ED effector domain of the CAP family of transc 99.58
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.57
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.57
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.53
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.52
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.51
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.51
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.51
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.51
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.51
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.5
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.49
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.49
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.48
KOG0614732 consensus cGMP-dependent protein kinase [Signal tr 99.46
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.46
KOG1710 396 consensus MYND Zn-finger and ankyrin repeat protei 99.45
KOG0515752 consensus p53-interacting protein 53BP/ASPP, conta 99.44
PLN02868413 acyl-CoA thioesterase family protein 99.43
COG2905 610 Predicted signal-transduction protein containing c 99.33
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.31
KOG0614 732 consensus cGMP-dependent protein kinase [Signal tr 99.31
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.31
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.26
KOG1113368 consensus cAMP-dependent protein kinase types I an 99.18
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 99.07
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 99.07
PF1360630 Ank_3: Ankyrin repeat 99.02
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.98
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.97
KOG0506622 consensus Glutaminase (contains ankyrin repeat) [A 98.95
KOG0818 669 consensus GTPase-activating proteins of the GIT fa 98.89
PF1360630 Ank_3: Ankyrin repeat 98.85
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.84
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.82
KOG0522 560 consensus Ankyrin repeat protein [General function 98.81
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.77
KOG0705749 consensus GTPase-activating protein Centaurin gamm 98.73
KOG07821004 consensus Predicted diacylglycerol kinase [Signal 98.7
KOG0783 1267 consensus Uncharacterized conserved protein, conta 98.7
KOG2384 223 consensus Major histocompatibility complex protein 98.68
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 98.66
KOG0522 560 consensus Ankyrin repeat protein [General function 98.64
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.61
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.57
KOG3609 822 consensus Receptor-activated Ca2+-permeable cation 98.39
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.38
KOG0511 516 consensus Ankyrin repeat protein [General function 98.27
KOG2384223 consensus Major histocompatibility complex protein 98.25
KOG0520 975 consensus Uncharacterized conserved protein, conta 98.16
KOG0511 516 consensus Ankyrin repeat protein [General function 98.16
KOG0521785 consensus Putative GTPase activating proteins (GAP 98.11
KOG2505591 consensus Ankyrin repeat protein [General function 97.64
KOG2968 1158 consensus Predicted esterase of the alpha-beta hyd 97.57
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.29
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.29
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.98
PRK11832207 putative DNA-binding transcriptional regulator; Pr 96.89
KOG2505591 consensus Ankyrin repeat protein [General function 96.75
PF04831153 Popeye: Popeye protein conserved region; InterPro: 96.74
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.62
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 96.38
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.25
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.18
KOG3542 1283 consensus cAMP-regulated guanine nucleotide exchan 93.72
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.98
PF00520200 Ion_trans: Ion transport protein calcium channel s 91.33
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 91.03
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 85.15
smart00835146 Cupin_1 Cupin. This family represents the conserve 80.95
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.3e-65  Score=536.10  Aligned_cols=409  Identities=32%  Similarity=0.514  Sum_probs=369.3

Q ss_pred             CeecccCCCC-CChhHHHHHHHHHHHHhhhhhceeeEEeCCceEEEechhHHHHHHhhhhhHHHhhccCCHHHHH-----
Q 013151            1 MEFAFFRGLP-ENLSILDIAGQIAFLVDIIMQFFLAYRDSQTYCLVYKLTRIALRYLKSSFIIDLLSCLPWDVIY-----   74 (448)
Q Consensus         1 ~~~~f~~~~~-~~~~~~~~~~~~~f~~di~~~f~~~~~~~~~~~~~~~~~~i~~~y~~~~f~~d~~~~~p~~~~~-----   74 (448)
                      |+++|..... ..|+++|+++|++|++||+++|+|+|+++++..+|.||++|++||+++||++|+++++|++++.     
T Consensus        81 ~~~~F~~~~~~~~~~~~d~i~~~~F~iDi~l~f~~ay~d~~~~~lV~d~~~I~~~Yl~~~f~~Dlis~lP~~~i~~~~~~  160 (823)
T PLN03192         81 FEVAFLNASPKRGLEIADNVVDLFFAVDIVLTFFVAYIDPRTQLLVRDRKKIAVRYLSTWFLMDVASTIPFQALAYLITG  160 (823)
T ss_pred             HHHHeeCCCCCCCeeeHHHHHHHHHHHHHHhheeEEEEeCCCcEEEeCHHHHHHHHHHHhHHHHHHHHhHHHHHHHHhcC
Confidence            5788976543 4589999999999999999999999999988778999999999999999999999999997541     


Q ss_pred             --------------------------------------------------------------------------------
Q 013151           75 --------------------------------------------------------------------------------   74 (448)
Q Consensus        75 --------------------------------------------------------------------------------   74 (448)
                                                                                                      
T Consensus       161 ~~~~~~~~~~l~llrl~Rl~ri~~~~~~le~~~~~~~~~~~~~kli~~~l~~~H~~aC~~y~i~~~~~~~~~~Wi~~~~~  240 (823)
T PLN03192        161 TVKLNLSYSLLGLLRFWRLRRVKQLFTRLEKDIRFSYFWIRCARLLSVTLFLVHCAGCLYYLIADRYPHQGKTWIGAVIP  240 (823)
T ss_pred             CccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCCCCchHHHhhh
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 013151           75 --------------------------------------------------------------------------------   74 (448)
Q Consensus        75 --------------------------------------------------------------------------------   74 (448)
                                                                                                      
T Consensus       241 ~~~~~s~~~~Yi~slYwai~TmtTVGYGDi~p~t~~E~i~~i~~ml~g~~~~a~~ig~i~~li~~~~~~~~~f~~~~~~~  320 (823)
T PLN03192        241 NFRETSLWIRYISAIYWSITTMTTVGYGDLHAVNTIEMIFIIFYMLFNLGLTAYLIGNMTNLVVEGTRRTMEFRNSIEAA  320 (823)
T ss_pred             ccccCcHHHHHHHHHHHHHHHHhhccCCCcCCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                                                                                            


Q ss_pred             ---------------------------------------------HHHHHhhHHHhhccccccCCCHHHHHHHHhhccee
Q 013151           75 ---------------------------------------------KISQTLYMPYIEKVSLFKGCSSEFINQIVIRVHEE  109 (448)
Q Consensus        75 ---------------------------------------------~i~~~~~~~~l~~~~~f~~l~~~~~~~l~~~~~~~  109 (448)
                                                                   +|+.+++.++++++|+|++++++++.+++..++++
T Consensus       321 ~~ym~~~~lp~~lq~ri~~y~~~~~~~~~~~~~~~l~~Lp~~Lr~~i~~~l~~~~l~~~~lF~~~s~~~l~~L~~~~~~~  400 (823)
T PLN03192        321 SNFVGRNRLPPRLKDQILAYMCLRFKAESLNQQQLIDQLPKSICKSICQHLFLPVVEKVYLFKGVSREILLLLVTKMKAE  400 (823)
T ss_pred             HHHHHHcCCCHHHHHHHHHHHHHHHhhccccHHHHHHHcCHHHHHHHHHHHHHHHHhhCcchhcCCHHHHHHHHHhhhee
Confidence                                                         77888888999999999999999999999999999


Q ss_pred             eeCCCCeEEecCCccCeEEEEEeeEEEEEeecCCCCeeEEEEecCCCeeecccccCCCCcceEEEEeeeeeEEEechhhH
Q 013151          110 FFLPGEVIMEQGNVVDQLYFVCHGVLEEVGVGEDGSEETVSQLQPNSSFGEVSILCNIPQPYTVCICELSRLLRIDKQSF  189 (448)
Q Consensus       110 ~~~~g~~i~~~g~~~~~~y~v~~G~v~~~~~~~~g~~~~~~~l~~G~~fGe~~ll~~~~~~~~~~a~~~~~l~~l~~~~~  189 (448)
                      .|+|||.|+.|||.++++|||.+|.|+++. ..+|++.++..+.+|++|||++++++.+++++++|.+.|+++.+++++|
T Consensus       401 ~~~pge~I~~qge~~~~lY~I~~G~V~i~~-~~~~~e~~l~~l~~Gd~FGE~~~l~~~p~~~t~ra~~~s~ll~l~~~~f  479 (823)
T PLN03192        401 YIPPREDVIMQNEAPDDVYIVVSGEVEIID-SEGEKERVVGTLGCGDIFGEVGALCCRPQSFTFRTKTLSQLLRLKTSTL  479 (823)
T ss_pred             eeCCCCEEEECCCCCceEEEEEecEEEEEE-ecCCcceeeEEccCCCEecchHHhcCCCCCCeEEEcccEEEEEEEHHHH
Confidence            999999999999999999999999999985 5567888999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhcchhhhhHhhhccchhH--HhhhhccccccccccchhhhhHHHHHHHhcCCHHHHHHHHHcCCCCCCCCCC
Q 013151          190 TNILEIYFCDGRKVLTNLLEGKESNL--RLKQLKSDITFHIGKHEAELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYD  267 (448)
Q Consensus       190 ~~ll~~~p~~~~~il~~ll~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~  267 (448)
                      .++++.+|..+..++..+++......  ....+..+...  ...+..+.++|+.||..|+.++++.|++.|+++|..|..
T Consensus       480 ~~ll~~~p~d~~~i~~~~l~~~~~l~~l~v~~ll~~~~~--~~~~~~~~~~L~~Aa~~g~~~~l~~Ll~~G~d~n~~d~~  557 (823)
T PLN03192        480 IEAMQTRQEDNVVILKNFLQHHKELHDLNVGDLLGDNGG--EHDDPNMASNLLTVASTGNAALLEELLKAKLDPDIGDSK  557 (823)
T ss_pred             HHHHHHhhHHHHHHHHHHHHHhhhhccccHHHHHhhccc--ccCCccchhHHHHHHHcCCHHHHHHHHHCCCCCCCCCCC
Confidence            99999999999999998886432111  11111111111  123345678999999999999999999999999999999


Q ss_pred             CCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHHHHHcCChhHHHHHHHcCCcccccCCchhHHHHHhcCCHHH
Q 013151          268 GRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDF  347 (448)
Q Consensus       268 g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~l~~A~~~~~~~~  347 (448)
                      |+||||+|+..|+.+++++|+++|+++|.+|.+|+||||+|+..|+.+++++|++.++..+..++.++||.|+..|+.++
T Consensus       558 G~TpLh~Aa~~g~~~~v~~Ll~~gadin~~d~~G~TpL~~A~~~g~~~iv~~L~~~~~~~~~~~~~~~L~~Aa~~g~~~~  637 (823)
T PLN03192        558 GRTPLHIAASKGYEDCVLVLLKHACNVHIRDANGNTALWNAISAKHHKIFRILYHFASISDPHAAGDLLCTAAKRNDLTA  637 (823)
T ss_pred             CCCHHHHHHHcChHHHHHHHHhcCCCCCCcCCCCCCHHHHHHHhCCHHHHHHHHhcCcccCcccCchHHHHHHHhCCHHH
Confidence            99999999999999999999999999999999999999999999999999999999988888888899999999999999


Q ss_pred             HHHHHHCCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCcCCCCCCC-CChhHHHHhcCCHH
Q 013151          348 LKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWG-NTPLDEGRMCGNKN  412 (448)
Q Consensus       348 v~~Ll~~g~~~~~~d~~g~TpLh~A~~~~~~~~v~~Ll~~gad~~~~d~~g-~tpl~~A~~~~~~~  412 (448)
                      ++.|+++|+++|.+|.+|+||||+|+..|+.+++++|+++|+|++..|..| .||++++......+
T Consensus       638 v~~Ll~~Gadin~~d~~G~TpLh~A~~~g~~~iv~~Ll~~GAdv~~~~~~g~~t~~~l~~~~~~~~  703 (823)
T PLN03192        638 MKELLKQGLNVDSEDHQGATALQVAMAEDHVDMVRLLIMNGADVDKANTDDDFSPTELRELLQKRE  703 (823)
T ss_pred             HHHHHHCCCCCCCCCCCCCCHHHHHHHCCcHHHHHHHHHcCCCCCCCCCCCCCCHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999988 99998886654433



>KOG0498 consensus K+-channel ERG and related proteins, contain PAS/PAC sensor domain [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4412 consensus 26S proteasome regulatory complex, subunit PSMD10 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only] Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0501 consensus K+-channel KCNQ [Inorganic ion transport and metabolism] Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0508 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG0500 consensus Cyclic nucleotide-gated cation channel CNGA1-3 and related proteins [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG4177 consensus Ankyrin [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG0505 consensus Myosin phosphatase, regulatory subunit [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>KOG0502 consensus Integral membrane ankyrin-repeat protein Kidins220 (protein kinase D substrate) [General function prediction only] Back     alignment and domain information
>KOG0507 consensus CASK-interacting adaptor protein (caskin) and related proteins with ankyrin repeats and SAM domain [Signal transduction mechanisms] Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG0512 consensus Fetal globin-inducing factor (contains ankyrin repeats) [Transcription] Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4369 consensus RTK signaling protein MASK/UNC-44 [Signal transduction mechanisms] Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676 consensus Ca2+-permeable cation channel OSM-9 and related channels (OTRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG4214 consensus Myotrophin and similar proteins [Transcription] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0515 consensus p53-interacting protein 53BP/ASPP, contains ankyrin and SH3 domains [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG1113 consensus cAMP-dependent protein kinase types I and II, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506 consensus Glutaminase (contains ankyrin repeat) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0818 consensus GTPase-activating proteins of the GIT family [Signal transduction mechanisms] Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0782 consensus Predicted diacylglycerol kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0783 consensus Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>KOG0522 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG3609 consensus Receptor-activated Ca2+-permeable cation channels (STRPC family) [Inorganic ion transport and metabolism; Signal transduction mechanisms] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2384 consensus Major histocompatibility complex protein BAT4, contains G-patch and ankyrin domains [General function prediction only] Back     alignment and domain information
>KOG0520 consensus Uncharacterized conserved protein, contains IPT/TIG domain [Function unknown] Back     alignment and domain information
>KOG0511 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>KOG2968 consensus Predicted esterase of the alpha-beta hydrolase superfamily (Neuropathy target esterase), contains cAMP-binding domains [General function prediction only] Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG2505 consensus Ankyrin repeat protein [General function prediction only] Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>KOG3542 consensus cAMP-regulated guanine nucleotide exchange factor [Signal transduction mechanisms] Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-29
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-29
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 9e-29
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-27
2xee_A157 Structural Determinants For Improved Thermal Stabil 8e-21
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-20
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-10
2xeh_A157 Structural Determinants For Improved Thermal Stabil 3e-20
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 8e-20
1uoh_A226 Human Gankyrin Length = 226 2e-18
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-18
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 4e-18
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 9e-18
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 9e-18
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-17
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-16
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-16
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-16
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-16
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 9e-16
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-15
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-15
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-15
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-15
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-05
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-15
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-05
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-15
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-05
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-15
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-15
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 3e-15
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 3e-15
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 9e-07
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-15
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 9e-15
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 2e-14
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-10
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 7e-14
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-13
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-13
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 8e-10
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-13
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 5e-13
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 5e-12
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 9e-09
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 8e-12
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-11
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-11
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 3e-11
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 3e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-11
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 4e-11
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 5e-11
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 7e-11
2xen_A91 Structural Determinants For Improved Thermal Stabil 7e-11
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 9e-11
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 4e-10
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-09
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 6e-10
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-10
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 9e-10
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 9e-10
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 6e-07
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 9e-10
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-09
3so8_A162 Crystal Structure Of Ankra Length = 162 8e-07
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-09
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 9e-07
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 1e-09
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-09
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-09
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 5e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-09
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-09
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 2e-09
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 3e-09
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-09
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-09
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-07
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 4e-09
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 3e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 5e-09
3uxg_A172 Crystal Structure Of Rfxank Length = 172 1e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-04
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-08
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 1e-07
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-07
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 4e-07
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 1e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-07
1ycs_B239 P53-53bp2 Complex Length = 239 8e-07
1ycs_B239 P53-53bp2 Complex Length = 239 9e-05
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 1e-06
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 1e-06
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 1e-06
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 2e-06
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 4e-06
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 5e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 9e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 2e-05
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 2e-05
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 2e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 3e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 5e-05
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 6e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 7e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 7e-04
1d9s_A136 Tumor Suppressor P15(Ink4b) Structure By Comparativ 8e-05
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 4e-04
1bi7_B156 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-04
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-04
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure

Iteration: 1

Score = 127 bits (319), Expect = 1e-29, Method: Compositional matrix adjust. Identities = 75/186 (40%), Positives = 98/186 (52%), Gaps = 31/186 (16%) Query: 233 AELALRVNSAAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGV 292 +EL R+ AA +G+ ++K LI GAD N +D DGR+PLH A G+++I LI KG Sbjct: 2 SELGKRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGA 61 Query: 293 DINIKDKFGNTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSFLCTAVARGDSDFLKRVL 352 D+N KD G TPL A K GH + LL+ +GA +N Sbjct: 62 DVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVN------------------------ 97 Query: 353 SNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKN 412 ++D D RTPLH AA EG + KLL+ GA V T D G TPLD R GN+ Sbjct: 98 -------AKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNTSDSDGRTPLDLAREHGNEE 150 Query: 413 LIKLLE 418 ++KLLE Sbjct: 151 IVKLLE 156
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1D9S|A Chain A, Tumor Suppressor P15(Ink4b) Structure By Comparative Modeling And Nmr Data Length = 136 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query448
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-46
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-45
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-45
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-44
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-42
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-41
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-31
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-26
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-46
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-42
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-33
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 9e-46
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-35
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-35
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-23
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-20
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-43
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-34
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 5e-41
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-37
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-35
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-28
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-41
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-39
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-35
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-21
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-40
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-24
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-19
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-40
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-36
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-40
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-36
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-32
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-28
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-27
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-25
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-40
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-30
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-27
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-18
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-39
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-34
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-26
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-24
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-39
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-27
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-26
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 5e-39
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-31
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-31
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-19
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 7e-32
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-38
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-31
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-30
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-38
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-31
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-38
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-34
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-29
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-23
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-21
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 6e-38
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-37
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-34
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-26
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-11
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-37
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-34
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-29
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-28
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-20
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-37
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-34
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-32
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-24
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-19
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-10
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-37
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-31
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-36
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-27
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-25
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-16
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-11
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-36
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-33
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 7e-32
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-36
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-36
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-36
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-27
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-19
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-28
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-11
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 9e-35
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 9e-34
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-27
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-18
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-34
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-12
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-33
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-24
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-15
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-33
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-27
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-27
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 2e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-32
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 5e-23
2rfa_A232 Transient receptor potential cation channel subfa 1e-32
2rfa_A232 Transient receptor potential cation channel subfa 3e-29
2rfa_A232 Transient receptor potential cation channel subfa 1e-21
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-32
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-30
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-08
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 6e-32
3ukn_A212 Novel protein similar to vertebrate potassium VOL 9e-31
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-29
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-29
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-17
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-06
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-30
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-25
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-16
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-28
1sw6_A327 Regulatory protein SWI6; transcription regulation, 8e-25
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 6e-28
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-25
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-15
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 7e-28
2pnn_A273 Transient receptor potential cation channel subfa 3e-27
2pnn_A273 Transient receptor potential cation channel subfa 2e-24
2pnn_A273 Transient receptor potential cation channel subfa 6e-21
2pnn_A273 Transient receptor potential cation channel subfa 4e-10
2etb_A256 Transient receptor potential cation channel subfam 9e-26
2etb_A256 Transient receptor potential cation channel subfam 6e-25
2etb_A256 Transient receptor potential cation channel subfam 1e-23
2etb_A256 Transient receptor potential cation channel subfam 1e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-13
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-08
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-22
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-23
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-22
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-06
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 2e-22
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 6e-19
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 7e-19
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 3e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-19
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 9e-16
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-15
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 4e-09
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-08
2pqq_A149 Putative transcriptional regulator; APC7345, strep 9e-19
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 4e-18
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 4e-18
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 9e-18
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 1e-17
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 2e-17
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 2e-16
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 2e-17
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 2e-17
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 3e-15
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 4e-17
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 2e-13
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 4e-16
4din_B381 CAMP-dependent protein kinase type I-beta regulat 4e-16
4din_B381 CAMP-dependent protein kinase type I-beta regulat 2e-13
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 1e-15
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 2e-15
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 6e-15
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 9e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-14
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 8e-14
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-13
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 4e-14
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 5e-14
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 5e-14
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 6e-14
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 6e-12
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-13
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 3e-13
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 3e-13
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-12
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-12
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-10
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 7e-09
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 4e-12
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 5e-12
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 2e-11
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 6e-11
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 5e-10
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 8e-10
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 2e-09
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 6e-09
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 7e-09
1ft9_A222 Carbon monoxide oxidation system transcription reg 4e-08
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 1e-07
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 2e-06
3b02_A195 Transcriptional regulator, CRP family; structural 8e-06
3uo9_A534 Glutaminase kidney isoform, mitochondrial; hydrola 1e-05
3uo9_A534 Glutaminase kidney isoform, mitochondrial; hydrola 6e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  163 bits (416), Expect = 6e-46
 Identities = 50/179 (27%), Positives = 84/179 (46%), Gaps = 2/179 (1%)

Query: 242 AAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFG 301
           AA    +   + L++ G   N     G +PLHLA   G+ ++   L+ K  + N+ +K G
Sbjct: 219 AAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSG 278

Query: 302 NTPLLEAIKCGHDGVTSLLVKEGASLNVDDAGSF--LCTAVARGDSDFLKRVLSNGVDPS 359
            TPL    + GH  V  +L+K G  ++      +  L  A   G+   +K +L +  D +
Sbjct: 279 LTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVN 338

Query: 360 SRDYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLLE 418
           ++     +PLH AA +G   +  LLL+ GAS       G TPL   +  G  ++  +L+
Sbjct: 339 AKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLK 397


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3jxi_A260 Vanilloid receptor-related osmotically activated p 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 100.0
3v31_A167 Ankyrin repeat family A protein 2; structural geno 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
3v30_A172 DNA-binding protein rfxank; structural genomics co 100.0
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 100.0
1awc_B153 Protein (GA binding protein beta 1); complex (tran 100.0
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.98
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.98
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.98
3hra_A201 Ankyrin repeat family protein; structural protein; 99.98
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.98
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.97
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.96
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.96
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.95
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.95
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.91
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.91
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.91
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.89
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.89
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.88
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.87
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.85
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.84
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.83
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.82
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.81
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.81
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.81
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.8
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.8
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.79
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.78
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.77
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.76
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.75
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.75
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.74
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.74
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.73
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.73
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.73
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.72
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.71
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.71
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.71
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.71
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.7
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.69
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.68
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.68
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.67
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.66
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.66
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.65
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.65
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.63
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.62
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.62
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.62
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.61
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.61
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.61
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.6
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.6
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.6
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.59
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.59
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.58
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.54
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.5
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.49
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.48
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.43
3b02_A195 Transcriptional regulator, CRP family; structural 99.39
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.33
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.28
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 96.49
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 92.84
1ors_C132 Potassium channel; voltage-dependent, voltage sens 88.24
2kyh_A147 KVAP, voltage-gated potassium channel; ION channel 80.74
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>1ors_C Potassium channel; voltage-dependent, voltage sensor, KVAP, FAB complex, membrane protein; 1.90A {Aeropyrum pernix} SCOP: f.14.1.1 Back     alignment and structure
>2kyh_A KVAP, voltage-gated potassium channel; ION channel, membrane protein; NMR {Aeropyrum pernix} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 448
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-34
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-27
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-25
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-23
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-20
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-17
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-15
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-09
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-26
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-22
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-17
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-13
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-20
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-13
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-11
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-18
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 8e-15
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-14
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-18
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-14
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-17
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-09
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 9e-04
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-15
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 9e-14
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-11
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 4e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-15
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-09
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 2e-15
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-10
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-07
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 3e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-13
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-10
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-07
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-04
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 5e-14
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 1e-13
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 2e-12
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 5e-12
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 7e-12
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 2e-11
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 1e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-09
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-07
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-05
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-08
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 2e-10
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 5e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-10
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 4e-09
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-09
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 5e-09
d1zyba2147 b.82.3.2 (A:1-147) Probable transcription regulato 9e-09
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 3e-08
d1o5la1129 b.82.3.2 (A:1-129) CRP-like transcriptional regula 9e-06
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-05
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 3e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 4e-04
d2zcwa2112 b.82.3.2 (A:6-117) Transcriptional regulator TTHA1 2e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  130 bits (327), Expect = 2e-34
 Identities = 52/218 (23%), Positives = 83/218 (38%), Gaps = 35/218 (16%)

Query: 242 AAYHGDLYQLKGLIRAGADPNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFG 301
           A++ G L  +K L++ GA PN ++    +PLH+A   G+ ++  +L+Q    +N K K  
Sbjct: 7   ASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDD 66

Query: 302 NTPLLEAIKCGHDGVTSLLVKEGASLN--------------------------------- 328
            TPL  A + GH  +  LL++  A+ N                                 
Sbjct: 67  QTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQA 126

Query: 329 -VDDAGSF-LCTAVARGDSDFLKRVLSNGVDPSSRDYDHRTPLHVAASEGLYLMAKLLLE 386
            +   G   L  A   G     + +L     P++   +  TPLHVA       + KLLL 
Sbjct: 127 CMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLP 186

Query: 387 AGASVFTKDRWGNTPLDEGRMCGNKNLIKLLEDAECTQ 424
            G S  +    G TPL          + + L     + 
Sbjct: 187 RGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSA 224


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query448
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.98
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.97
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.97
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.96
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.95
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.95
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.94
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.93
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.93
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.92
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.83
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.82
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.81
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.8
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.8
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.79
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.77
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.77
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.76
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.76
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.74
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.7
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.69
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.67
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.64
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.64
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.59
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 93.08
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 88.25
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Transcription factor inhibitor I-kappa-B-beta, IKBB
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1.3e-38  Score=287.43  Aligned_cols=193  Identities=24%  Similarity=0.235  Sum_probs=177.4

Q ss_pred             chhhhhHHHHHHHhcCCHHHHHHHHHcCCC---CCCCCCCCCcHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCcHHHH
Q 013151          231 HEAELALRVNSAAYHGDLYQLKGLIRAGAD---PNKTDYDGRSPLHLATSRGYEDITLFLIQKGVDINIKDKFGNTPLLE  307 (448)
Q Consensus       231 ~~~~~~~~L~~A~~~g~~~~v~~Ll~~g~~---~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~~~~~~~~~~~g~t~L~~  307 (448)
                      -+.+|.||||+||..|+.+++++|+++|++   ++.+|..|.||||+|+..|+.+++++|+++|++++..|..|.||||+
T Consensus         5 i~~~G~t~Lh~A~~~~~~~~v~~Ll~~~a~~~~i~~~~~~g~TpL~~A~~~g~~~iv~~Ll~~ga~i~~~d~~g~tpL~~   84 (255)
T d1oy3d_           5 VTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEASTVEKLYAAGAGVLVAERGGHTALHL   84 (255)
T ss_dssp             CCTTCCCHHHHHHHTTCHHHHHHHHHHHTTSGGGGCCCTTSCCHHHHHHHHTCHHHHHHHHHTTCCSSCCCTTSCCHHHH
T ss_pred             CCcCCCCHHHHHHHcCCHHHHHHHHHcCCCcccccCcCCCCCCccchHHhhcccccccccccccccccccccccchhhhh
Confidence            357899999999999999999999999988   56788999999999999999999999999999999999999999999


Q ss_pred             HHHcCChhHHHHHHHcCCccc-------------------------------------------------ccCCchhHHH
Q 013151          308 AIKCGHDGVTSLLVKEGASLN-------------------------------------------------VDDAGSFLCT  338 (448)
Q Consensus       308 A~~~~~~~~v~~Ll~~g~~~~-------------------------------------------------~~~~~~~l~~  338 (448)
                      |+..++.+++++|++.+....                                                 ..+|.||||+
T Consensus        85 A~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~in~~d~~g~TpLh~  164 (255)
T d1oy3d_          85 ACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCTPDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHV  164 (255)
T ss_dssp             HTTTTCHHHHHHHSSSCCSSCCCC-----------------------------------CCCGGGGTTCCCTTSCCHHHH
T ss_pred             hhccCchHHHHHHHhhccchhcccchhhhhHHhhhcccchHHHHHHHhhcchhHHHHHHhhhcCcccccccccCcccccc
Confidence            999999999999976532210                                                 1235689999


Q ss_pred             HHhcCCHHHHHHHHHCCCCCCCC-CCCCCcHHHHHHHcCcHHHHHHHHHCCCCcCCCCCCCCChhHHHHhcCCHHHHHHH
Q 013151          339 AVARGDSDFLKRVLSNGVDPSSR-DYDHRTPLHVAASEGLYLMAKLLLEAGASVFTKDRWGNTPLDEGRMCGNKNLIKLL  417 (448)
Q Consensus       339 A~~~~~~~~v~~Ll~~g~~~~~~-d~~g~TpLh~A~~~~~~~~v~~Ll~~gad~~~~d~~g~tpl~~A~~~~~~~~v~~L  417 (448)
                      |+..++.+++++|++++++.+.. +..|.||||+|+..|+.+++++|+++|+|++.+|..|+||||+|+.+|+.+++++|
T Consensus       165 A~~~~~~~~v~~Ll~~~~~~~~~~~~~g~TpL~~A~~~~~~~~v~~Ll~~gadin~~d~~g~t~L~~A~~~~~~~i~~~L  244 (255)
T d1oy3d_         165 AVIHKDAEMVRLLRDAGADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPILARLL  244 (255)
T ss_dssp             HHHTTCHHHHHHHHHHTCCTTCCCTTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHTSSCHHHHHHH
T ss_pred             cccccccccccchhcccccccccccccccccccccccccHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHCCCHHHHHHH
Confidence            99999999999999999998865 67899999999999999999999999999999999999999999999999999999


Q ss_pred             HHhccc
Q 013151          418 EDAECT  423 (448)
Q Consensus       418 l~~~~~  423 (448)
                      +++||+
T Consensus       245 l~~Ga~  250 (255)
T d1oy3d_         245 RAHGAP  250 (255)
T ss_dssp             HHTTCC
T ss_pred             HHcCCC
Confidence            999996



>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure