Citrus Sinensis ID: 013174


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MAVTDTENPLLGETTCSSLLHKLQEIWDEVGENDEERDKMLLQIEKECLDVYKRKVEQAAKSRAQLLQALSDAKIELASLLSALGEKSIAGLGIPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQSQIQKICGEIAGNLSLGDQAPSVDESDLTLKKLDEYQAQLQELQKEKSDRLHKVLEFVSTVHDLCGVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLALKEDKKQRLHKLQELATQLIDLWNLMDTPSEERRLFDHVTCNISAYVDGVTVPGALALDLIEQAEVEVERLDQLKASRMKEIAFKRQGELEEIFARAHIEIDPVAAREKIMTLIDSGNVEPAELLADMDNQIAKAKEEAHSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKIPGMPRIPEQPCYDN
cccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccHHHccccccHHHHHHHHHHHHHHccccccccccccccccc
*************TTCSSLLHKLQEIWDEVGENDEERDKMLLQIEKECLDVYKRKVEQAA**RAQLLQALSDAKIELASLLSALGEKSIA********SGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQSQIQKICGEIAGNLSLG**APSVDESDLTLKKLDEYQAQLQELQKEKSDRLHKVLEFVSTVHDLCGVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLALKEDKKQRLHKLQELATQLIDLWNLMDTPSEERRLFDHVTCNISAYVDGVTVPGALALDLIEQAEVEVERLDQLKASRMKEIAFKRQGELEEIFARAHIEIDPVAAREKIMTLIDSGNVEPAELLADMDNQIAKAKEEAHSRKEILDKVEKWMSACEEESWLEDY********************EKARILVNKIPGMPRIPE******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVTDTENPLLGETTCSSLLHKLQEIWDEVGENDEERDKMLLQIEKECxxxxxxxxxxxxxxxxxxxxxxxxxxxxLASLLSALGEKSIAGLGIPEKTSGTIKEQLAAIAPALEQLWKQKEERVKEFSDVQSQIQKICGEIAGNLSLGDQAPSVDExxxxxxxxxxxxxxxxxxxxxxxxxxxxVLEFVSTVHDLCGVLGMDFFSTVTEVHPSLNDSTGVQSKSISNDTLARLAKTVLALxxxxxxxxxxxxxxxxxxxxxWNLMDTPSEERRLFDHVTCNISAYVDGVTVPGALALDLxxxxxxxxxxxxxxxxxxxxxIAFKRQGELEEIFARAHIEIDPVAAREKIMTLIDSGNVEPAELLADMDNQIAKAKEEAHSRKEILDKVEKWMSACEEESWLEDYNRDENRYNASRGAHLNLKRAEKARILVNKIPGMPRIPEQPCYDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
65-kDa microtubule-associated protein 1 Microtubule-associated protein that bundle and stabilize adjacent microtubules (MT) of the cell cortex. Enhances MT nucleation. Can also bind to tubulin dimers and promotes their polymerization. Confers MT resistance to the drug propyzamide and cold conditions. Plays a role in the central spindle at anaphase to early cytokinesis but is not essential at the midline of the phragmoplast at later stages. Represses metaphase spindle organization and the transition to anaphase in dephosphorylated active form. Promotes the formation of a planar network of antiparallel microtubules. May be involved in stomatal movement modulation by regulating the dynamic and arrangement of cortical MT.probableQ9FLP0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NRX, chain A
Confidence level:confident
Coverage over the Query: 372-445
View the alignment between query and template
View the model in PyMOL