Citrus Sinensis ID: 013209

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------
MEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAWQYLDKLFTGYYVQDFEVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVWAHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTRLFNSITSVFYGRKLDFDPVARFLVSYQHWTFYPVMCVARVNLYLQTLLLLFSKRKVPDRALNIMGTLVFWTWFPLLVSYLPNWPERVMFVMASFTVTAIQHIQFCLNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLRGAALQARDLTNPVPKNLLWEALNTHG
cccccccccHHHHHHccccccEEEEEccEEEEccccccccccccHHHHccccccccHHHHHccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHcccccccHHHHHcccccccccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcEEEEEEEcccccccccccccccccHHHHHHHcccccccccccccEECcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccc
****KKY***EELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAWQYLDKLFTGYYVQDFEVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVWAHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTRLFNSITSVFYGRKLDFDPVARFLVSYQHWTFYPVMCVARVNLYLQTLLLLFSKRKVPDRALNIMGTLVFWTWFPLLVSYLPNWPERVMFVMASFTVTAIQHIQFCLNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLRGAALQARDLTNPVPKNLLWEALNTH*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEAEKKYITAEELRTHNKAEDLWISIQGKVYDVTEWAKQHPGGDVPLLNLAGQDVTDAFIAYHPGTAWQYLDKLFTGYYVQDFEVSEISKDYRRLYIEFAKQGMFEKKQHVASCALTCVALMFVVVVYGVLCCESVWAHLGSGMLLGFLWIQSAYVGHDSGHYQVMTSPKFNKIAQLISGNCLTGISIAWWKWTHNAHHIACNSLDYDPDLQHIPVFAVSTRLFNSITSVFYGRKLDFDPVARFLVSYQHWTFYPVMCVARVNLYLQTLLLLFSKRKVPDRALNIMGTLVFWTWFPLLVSYLPNWPERVMFVMASFTVTAIQHIQFCLNHFAANVYLGPPKGNDWFEKQTSGTLDIACSSWMDWFHGGLQFQLEHHLFPRLPRCQLRKISPVVRDLCKKHNMPYRSLSFFEANVWTIRTLRGAALQARDLTNPVPKNLLWEALNTHG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Delta(8)-fatty-acid desaturase Delta(8)-fatty-acid desaturase which introduces a double bond at the 8-position in 20-carbon fatty acids that have an existing delta-11 unsaturation. Involved in the biosynthesis of sphingolipids. In addition to their role as membrane components, sphingolipids act as secondary messengers by controlling metabolism and cell growth.probableQ43469
Delta(8)-fatty-acid desaturase Delta(8)-fatty-acid desaturase which introduces a double bond at the 8-position in 20-carbon fatty acids that have an existing delta-11 unsaturation. Involved in the biosynthesis of sphingolipids. In addition to their role as membrane components, sphingolipids act as secondary messengers by controlling metabolism and cell growth.probableQ9FR82

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HKO, chain A
Confidence level:very confident
Coverage over the Query: 2-85
View the alignment between query and template
View the model in PyMOL