Citrus Sinensis ID: 013295

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440------
MMNGPSTEDRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQVRVL
cccccccccccccccHHHHHHHHccccHHHHHHHHHHcccccccccccccEEEEccccHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccEEEEEEEEEcccccccccccccEEEEEEEEEEccHHHHHHHccccccEEEEEcEEEccccEEEEEEcccccEEEEEcccccccccccEEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEcEEEcccccccHHHHHHHHHHcccccccEEEEEcccEEEEEEccccccccccccccccEEEEEEEccccHHHHHHHHHccccccEEEEEccccccccccccccccccccEEEEEEEEEEccHHHHHHHHHHHHcccccccEEEEcccccccccHHHHHHHHHcccccccccEEEEc
cccccccccHHccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHHHcccEEEEEEEcccccccccccEEEcccEEEEEEEcEEEcccccccccHcHcEEEEEEEEEcHHHHHHHHHcccHHHEEEEEEccccccEEEEEEEccccEEEEEEEcccccccccccEEEEEcccEEEEEEEccccccEEEEcccccEEEEEEEEEccccccccccccHHHHHHHHHccHcccEEEEcccHHHHHHcccccccccccccccEEEEEEEEccccHHHHHHHHHHccccccEEEEEccccccccccccccHHHHccEEEEEEEcccccHHHHHHHHHHHHHcHHHEEEEEEcccccccHHHHHHHHHHHcccccccccEEEEc
mmngpstedrisclpnaiLCHILSFLPTKYAVATCVLSSTWKLVWtslpnlcfddrlCLEFQRNLDLSTVASTRFENFVHRVLLSAsgninkfslrccglvdssrLKLWVSFATMRNVREIEislnddecielphciytcKTLEVLKLDMnffiktpptiffpsAKILHVILNTIdnnfsdwlfskcpaledlsikgyiygtdsvtlnipslTLKRLRLEleapeedyiTKYKVIIrapnleqlyirdhgpglyvVHELHSLTKAVVDYGIEcildydspeDVAQAVVDMLRDIKNikslslssgtmfaldrldyandhsfptfpflnrlevegvgacgwlSLAHIFsrmpklesivfeegvdfewpepslalgcllSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGeqfqrrgskEEVYEQILLFErgsktcqvrvl
MMNGPSTEDRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEislnddecieLPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTdsvtlnipslTLKRLRLELeapeedyitkYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNikslslssgTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGgeqfqrrgsKEEVYEQIllfergsktcqvrvl
MMNGPSTEDRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNffiktpptiffpSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQVRVL
**********ISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERG*********
*****ST***ISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQVRVL
*********RISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQVRVL
********DRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQVRVL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMNGPSTEDRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQVRVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query446 2.2.26 [Sep-21-2011]
Q8L7H1381 F-box/LRR-repeat protein no no 0.760 0.889 0.336 1e-34
Q94B46468 F-box/LRR-repeat protein no no 0.946 0.901 0.306 7e-33
Q9FNJ4443 Putative F-box/FBD/LRR-re no no 0.939 0.945 0.298 7e-31
Q9SCQ5427 Putative FBD-associated F no no 0.890 0.929 0.286 2e-29
Q9FM89422 F-box/FBD/LRR-repeat prot no no 0.899 0.950 0.264 5e-28
Q9C8Y8453 Putative F-box/FBD/LRR-re no no 0.932 0.918 0.278 3e-27
Q8H1M0442 F-box/FBD/LRR-repeat prot no no 0.941 0.950 0.278 3e-27
Q9FZ52449 F-box/FBD/LRR-repeat prot no no 0.905 0.899 0.276 3e-27
Q9ZV93458 F-box/FBD/LRR-repeat prot no no 0.943 0.919 0.286 1e-26
Q9M190 532 Putative F-box/LRR-repeat no no 0.912 0.765 0.286 1e-26
>sp|Q8L7H1|FBL75_ARATH F-box/LRR-repeat protein At4g14103 OS=Arabidopsis thaliana GN=At4g14103 PE=2 SV=1 Back     alignment and function desciption
 Score =  147 bits (372), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 126/374 (33%), Positives = 185/374 (49%), Gaps = 35/374 (9%)

Query: 2   MNGPSTEDRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEF 61
           M+   + D IS LP+ I  HILSFLPTK A +T VLS  W+ ++  +PNL  DD + L  
Sbjct: 1   MDLSGSRDVISSLPDDISSHILSFLPTKEAASTSVLSKKWRYLFAFVPNLDLDDSVYL-- 58

Query: 62  QRNLDLSTVASTRFENFVHRVL-LSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVRE 120
             N +  T  ST F +FV RVL L  +  ++KFSL+    +D  R+  W++    R V +
Sbjct: 59  --NPENETEISTSFMDFVDRVLALQGNSPLHKFSLKIGDGIDPVRIIPWINNVLERGVSD 116

Query: 121 IEISLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTI-----FFPSAKILHVILNTI 175
           +++ LN +    LP  +Y CKTL  LKL    +    PTI       P  K L++     
Sbjct: 117 LDLHLNLESEFLLPSQVYLCKTLVWLKLRFGLY----PTIDVEDVHLPKLKTLYIEATHF 172

Query: 176 DNNFSDW--LFSKCPALEDL---SIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEEDYIT 230
           + +      L S CP LEDL    I  +I+  D  ++++P  TLKRLR   +  E D   
Sbjct: 173 EEHGVGLTKLLSGCPMLEDLVLDDISWFIW--DFASVSVP--TLKRLRFSWQ--ERDEFP 226

Query: 231 KYKVIIRAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGI--ECILDYD---SPEDVAQ 285
           K  V++  PNL  L   D   G Y    L SL +A +D  +    +++Y       D+  
Sbjct: 227 K-SVLLDTPNLVYLKFTDTVAGKYPKVNLDSLVEAHIDLRLLKPLLINYHQGYGENDMVG 285

Query: 286 AVVDMLRDIKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAH 345
              D +  I N+K+L LS+ T   L  L Y+ D + P F  L  L +E     GW S+  
Sbjct: 286 NATDFIMRICNVKTLYLSANT---LQVLTYSCD-AIPIFNNLTHLTIESNPRVGWQSVPG 341

Query: 346 IFSRMPKLESIVFE 359
           +    P LE+++F+
Sbjct: 342 LLKNSPNLETLIFQ 355

Arabidopsis thaliana (taxid: 3702)
>sp|Q94B46|FBL74_ARATH F-box/LRR-repeat protein At4g14096 OS=Arabidopsis thaliana GN=At4g14096 PE=2 SV=1 Back     alignment and function description
>sp|Q9FNJ4|FDL32_ARATH Putative F-box/FBD/LRR-repeat protein At5g22670 OS=Arabidopsis thaliana GN=At5g22670 PE=4 SV=1 Back     alignment and function description
>sp|Q9SCQ5|FBD10_ARATH Putative FBD-associated F-box protein At3g50710 OS=Arabidopsis thaliana GN=At3g50710 PE=4 SV=1 Back     alignment and function description
>sp|Q9FM89|FDL38_ARATH F-box/FBD/LRR-repeat protein At5g56420 OS=Arabidopsis thaliana GN=At5g56420 PE=2 SV=1 Back     alignment and function description
>sp|Q9C8Y8|FDL7_ARATH Putative F-box/FBD/LRR-repeat protein At1g66290 OS=Arabidopsis thaliana GN=At1g66290 PE=4 SV=1 Back     alignment and function description
>sp|Q8H1M0|FDL16_ARATH F-box/FBD/LRR-repeat protein At2g26030 OS=Arabidopsis thaliana GN=At2g26030 PE=2 SV=2 Back     alignment and function description
>sp|Q9FZ52|FDL3_ARATH F-box/FBD/LRR-repeat protein At1g16930 OS=Arabidopsis thaliana GN=At1g16930 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZV93|FDL10_ARATH F-box/FBD/LRR-repeat protein At1g78750 OS=Arabidopsis thaliana GN=At1g78750 PE=2 SV=1 Back     alignment and function description
>sp|Q9M190|FBL49_ARATH Putative F-box/LRR-repeat protein At3g42770 OS=Arabidopsis thaliana GN=At3g42770 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
147812093 607 hypothetical protein VITISV_040899 [Viti 0.961 0.706 0.356 4e-52
296086770411 unnamed protein product [Vitis vinifera] 0.869 0.944 0.340 1e-42
224114976462 predicted protein [Populus trichocarpa] 0.948 0.915 0.328 1e-38
334186507443 F-box/LRR-repeat protein [Arabidopsis th 0.903 0.909 0.316 3e-35
18414142381 F-box/LRR-repeat protein [Arabidopsis th 0.760 0.889 0.336 9e-33
296086764348 unnamed protein product [Vitis vinifera] 0.724 0.928 0.337 9e-33
18414140468 F-box/LRR-repeat protein [Arabidopsis th 0.946 0.901 0.306 5e-31
297819758426 F-box family protein [Arabidopsis lyrata 0.894 0.936 0.296 8e-31
15242935443 F-box/FBD/LRR-repeat protein [Arabidopsi 0.939 0.945 0.298 5e-29
224113879460 predicted protein [Populus trichocarpa] 0.905 0.878 0.295 5e-28
>gi|147812093|emb|CAN74740.1| hypothetical protein VITISV_040899 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  211 bits (538), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 162/455 (35%), Positives = 234/455 (51%), Gaps = 26/455 (5%)

Query: 7   TEDRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLD 66
           + D IS LP+ +LCHILSFLPTK+AV T +LS  W+ +W S+P L FDD L L     ++
Sbjct: 8   SRDIISNLPDELLCHILSFLPTKFAVGTSILSKRWRYLWASVPILDFDDELWLNPSTLVE 67

Query: 67  LSTVASTRFENFVHRVLL-SASGNINKFSLRCCGLVDSS--RLKLWVSFATMRNVREIEI 123
           L       F+NFV  VL  S    I KF L   G  D++   +  W+  A  R V+E+++
Sbjct: 68  LEE-RIIMFQNFVDGVLRHSEVSCIKKFRL---GYRDNNLDSVYSWICIALERRVQELDL 123

Query: 124 SLNDDECIELPHCIYTCKTLEVLKLDMNFFIKTPPTIFFPSAKILHV-ILNTIDNNFSDW 182
            L  D  +ELP   + CKTL V+KL    F+  P T++ PS K LH+  +   D++    
Sbjct: 124 HLLIDWRVELPPMFFICKTLVVVKLSCALFLDIPTTVWLPSLKALHLKSVEYSDDDSIQK 183

Query: 183 LFSKCPALEDLSIKGYIYGTDSVTLNIPSLTLKRLRL-----ELEAPEEDYITKYKVIIR 237
           L S CP LE+L I+        V +N+ + +LK LR+         P E     YKV++ 
Sbjct: 184 LLSGCPVLEELVIEREERDNQWV-VNVSNPSLKILRIFFFTDGFAHPYEQEDQDYKVVVD 242

Query: 238 APNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQA----VVDMLRD 293
           APNLE L I D+    Y V +L SL KA +D   +     +SP +   +    + ++L  
Sbjct: 243 APNLEYLSITDYLSKDYFVKDLPSLVKAFIDVEQDSEEFEESPHNGGISYHGPIYELLGR 302

Query: 294 IKNIKSLSLSSGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKL 353
           I N+K LSL+  T+ +L       D+  PTF  + RLE   +G   W  L +     P L
Sbjct: 303 ISNVKCLSLTGVTLDSLS--GTIGDYKLPTFHNMTRLEFLFIGGFNWDFLPNFLHSSPNL 360

Query: 354 ESIVFEEGVDFE-----WPEPSLALGCLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVL 408
           E++V E G   E     W  P     CL+ H+K I I    GE+ E++ ++YLLKN EVL
Sbjct: 361 EALVIETGYTNELIPEGWLMPLQVPACLVLHLKEIEIRRIVGEDYELEAVEYLLKNAEVL 420

Query: 409 NAMIIGGEQFQRRGSKEEVYEQILLFERGSKTCQV 443
             M I   +      +  V +++L   RGS++C V
Sbjct: 421 QQMTIDCHE-SYMDQEFCVCKKLLGLPRGSRSCFV 454

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086770|emb|CBI32919.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224114976|ref|XP_002316907.1| predicted protein [Populus trichocarpa] gi|222859972|gb|EEE97519.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|334186507|ref|NP_001190724.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|332657973|gb|AEE83373.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|18414142|ref|NP_567422.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75245750|sp|Q8L7H1.1|FBL75_ARATH RecName: Full=F-box/LRR-repeat protein At4g14103 gi|22136642|gb|AAM91640.1| unknown protein [Arabidopsis thaliana] gi|332657972|gb|AEE83372.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|296086764|emb|CBI32913.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|18414140|ref|NP_567421.1| F-box/LRR-repeat protein [Arabidopsis thaliana] gi|75249810|sp|Q94B46.1|FBL74_ARATH RecName: Full=F-box/LRR-repeat protein At4g14096 gi|14596145|gb|AAK68800.1| Unknown protein [Arabidopsis thaliana] gi|22136112|gb|AAM91134.1| unknown protein [Arabidopsis thaliana] gi|332657971|gb|AEE83371.1| F-box/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297819758|ref|XP_002877762.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] gi|297323600|gb|EFH54021.1| F-box family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15242935|ref|NP_197659.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] gi|75262763|sp|Q9FNJ4.1|FDL32_ARATH RecName: Full=Putative F-box/FBD/LRR-repeat protein At5g22670 gi|10178241|dbj|BAB11673.1| unnamed protein product [Arabidopsis thaliana] gi|332005679|gb|AED93062.1| F-box/FBD/LRR-repeat protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224113879|ref|XP_002316602.1| predicted protein [Populus trichocarpa] gi|222859667|gb|EEE97214.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query446
TAIR|locus:505006456468 AT4G14096 "AT4G14096" [Arabido 0.939 0.895 0.311 1.7e-34
TAIR|locus:2162499443 AT5G22670 "AT5G22670" [Arabido 0.939 0.945 0.296 2e-33
TAIR|locus:2201512453 AT1G66290 "AT1G66290" [Arabido 0.928 0.913 0.277 2.6e-31
TAIR|locus:2037578458 AT1G78750 "AT1G78750" [Arabido 0.957 0.932 0.279 4.2e-31
TAIR|locus:2026761451 AT1G69630 [Arabidopsis thalian 0.943 0.933 0.281 8.8e-31
TAIR|locus:2162489450 AT5G22660 "AT5G22660" [Arabido 0.950 0.942 0.268 2.3e-30
TAIR|locus:2057422442 AT2G26030 "AT2G26030" [Arabido 0.941 0.950 0.274 3.8e-30
TAIR|locus:2015681449 AT1G16930 "AT1G16930" [Arabido 0.912 0.906 0.278 9.1e-29
TAIR|locus:2101674427 AT3G50710 "AT3G50710" [Arabido 0.894 0.934 0.289 9.1e-29
TAIR|locus:505006455459 FBD1 "AT4G13985" [Arabidopsis 0.941 0.915 0.267 1.5e-26
TAIR|locus:505006456 AT4G14096 "AT4G14096" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 374 (136.7 bits), Expect = 1.7e-34, P = 1.7e-34
 Identities = 144/462 (31%), Positives = 214/462 (46%)

Query:     9 DRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDDRLCLEFQRNLDLS 68
             D IS LP AI CHILSFLPTK A +T VLS  W+ ++  +PNL  D+ + L    N +  
Sbjct:     8 DIISSLPEAISCHILSFLPTKEAASTSVLSKKWRYLFAFVPNLDLDESVYL----NPENE 63

Query:    69 TVASTRFENFVHRVL-LSASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLND 127
             T  S+ F +FV RVL L  +  ++KFSL+    V+  R+  W++    R V ++++ +  
Sbjct:    64 TEVSSSFMDFVDRVLALQGNSPLHKFSLKIGDGVEPDRIIPWINNVLERGVSDLDLHVYM 123

Query:   128 DECIELPHCIYTCKTLEVLKLDMNXXXXXXXXXXXXSAKILHVILNTIDNNFSDW--LFS 185
             +     P  ++  KTL  LKL M               K L++     +        L S
Sbjct:   124 ETEFVFPSEMFLSKTLVRLKL-MLYPLLEFEDVYLPKLKTLYIDSCYFEKYGIGLTKLLS 182

Query:   186 KCPALEDLSIKGYIYGT-DSVTLNIPSLTLKRLRLELEAPEEDYITKYKVIIRAPNLEQL 244
              CP LEDL +    + T D  ++++P  TLKRL    +  +E    K  V I  PNL  L
Sbjct:   183 GCPILEDLVLDDIPWCTWDFASVSVP--TLKRLTFSTQVRDE--FPK-SVSIDTPNLVYL 237

Query:   245 YIRDHGPGLYVVHELHSLTKAVVDYGI-ECILDYDSPEDVAQAVVDMLRDIKNIKSLSLS 303
                D   G Y      SL +A +D  + +    Y   + V  A  D +  I N+K+L LS
Sbjct:   238 KFTDTVAGKYPKVNFDSLVEAHIDLRLLQGHQGYGENDMVGNAT-DFIMRICNVKTLYLS 296

Query:   304 SGTMFALDRLDYANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGV- 362
             S T   L  L Y+ D + P F  L  L +E     GW SL  +    P LE+++F+  + 
Sbjct:   297 SNT---LQVLTYSCD-AIPIFNNLTHLTIESNPEVGWQSLPGLLKNSPNLETLIFQGLIH 352

Query:   363 -------DFEWPEPSLAL-GCLLSH----VKIIVIGEFEGE-ENEMKLIKYLLKNGEVLN 409
                    D    +P   +  CL S     +KI+  GE   + E + + IKY L+    L 
Sbjct:   353 KATDKCGDVCLCKPREEIRSCLASSPVKVIKILKFGEISDDMEKQREQIKYFLETMPNLE 412

Query:   410 AMIIGGEQFQRRGSKEEVYE-----QILLFERGSKTCQVRVL 446
              MI+    +    S E+V E     Q L+ +  S TC V+++
Sbjct:   413 KMIL----YYNTTSVEDVTEVSSRLQRLVSKLASSTCIVQLI 450
GO:0003674 "molecular_function" evidence=ND
GO:0005575 "cellular_component" evidence=ND
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2162499 AT5G22670 "AT5G22670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2201512 AT1G66290 "AT1G66290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037578 AT1G78750 "AT1G78750" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2026761 AT1G69630 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2162489 AT5G22660 "AT5G22660" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2057422 AT2G26030 "AT2G26030" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2015681 AT1G16930 "AT1G16930" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101674 AT3G50710 "AT3G50710" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:505006455 FBD1 "AT4G13985" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00000983001
SubName- Full=Chromosome chr19 scaffold_111, whole genome shotgun sequence; (310 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
smart0057972 smart00579, FBD, domain in FBox and BRCT domain co 2e-14
pfam0838751 pfam08387, FBD, FBD 4e-11
pfam0064648 pfam00646, F-box, F-box domain 2e-04
>gnl|CDD|214730 smart00579, FBD, domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information 
 Score = 67.9 bits (167), Expect = 2e-14
 Identities = 25/72 (34%), Positives = 40/72 (55%), Gaps = 1/72 (1%)

Query: 375 CLLSHVKIIVIGEFEGEENEMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQILLF 434
           CLLS ++++ I  + G E E +L+KY L+N   L  + I  E       K E+ +++L  
Sbjct: 2   CLLSSLEVLEIKGYRGTEEEKELVKYFLENAPCLKKLTISVE-TSDDEEKLEILKELLSL 60

Query: 435 ERGSKTCQVRVL 446
            R S +CQV+ L
Sbjct: 61  PRASSSCQVQFL 72

Length = 72
>gnl|CDD|203925 pfam08387, FBD, FBD Back     alignment and domain information
>gnl|CDD|201368 pfam00646, F-box, F-box domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 446
KOG4341483 consensus F-box protein containing LRR [General fu 99.78
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 99.72
smart0057972 FBD domain in FBox and BRCT domain containing plan 99.29
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.21
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.09
PF0838751 FBD: FBD; InterPro: IPR013596 This region is found 99.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.94
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 98.86
PF1293747 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 98.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.74
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.67
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.58
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.54
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.53
PF0064648 F-box: F-box domain; InterPro: IPR001810 The F-box 98.41
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 98.33
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.32
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.29
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 98.26
smart0025641 FBOX A Receptor for Ubiquitination Targets. 98.26
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.23
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 98.16
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.15
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.14
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 98.13
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.06
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.87
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 97.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.86
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 97.8
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.79
KOG0472565 consensus Leucine-rich repeat protein [Function un 97.76
KOG4341483 consensus F-box protein containing LRR [General fu 97.75
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 97.37
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.35
KOG1947482 consensus Leucine rich repeat proteins, some prote 97.32
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.27
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.22
KOG4237498 consensus Extracellular matrix protein slit, conta 97.22
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.13
PF0772326 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Le 97.06
KOG2982418 consensus Uncharacterized conserved protein [Funct 96.97
KOG0617264 consensus Ras suppressor protein (contains leucine 96.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 96.88
KOG0617264 consensus Ras suppressor protein (contains leucine 96.8
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 96.77
KOG1259490 consensus Nischarin, modulator of integrin alpha5 96.7
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 96.45
PLN03150623 hypothetical protein; Provisional 96.29
KOG1259490 consensus Nischarin, modulator of integrin alpha5 95.95
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 95.94
KOG0472 565 consensus Leucine-rich repeat protein [Function un 95.92
KOG3665 699 consensus ZYG-1-like serine/threonine protein kina 95.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 95.56
PRK15386426 type III secretion protein GogB; Provisional 95.5
KOG0281499 consensus Beta-TrCP (transducin repeats containing 95.47
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 95.28
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 95.08
PLN03150623 hypothetical protein; Provisional 94.85
KOG2123388 consensus Uncharacterized conserved protein [Funct 94.83
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 94.52
KOG2997366 consensus F-box protein FBX9 [General function pre 94.49
PLN03215373 ascorbic acid mannose pathway regulator 1; Provisi 94.34
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 94.06
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 93.7
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 93.63
KOG4237498 consensus Extracellular matrix protein slit, conta 92.64
KOG2123 388 consensus Uncharacterized conserved protein [Funct 91.96
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 89.24
KOG0274537 consensus Cdc4 and related F-box and WD-40 protein 87.72
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 86.88
KOG3864221 consensus Uncharacterized conserved protein [Funct 85.65
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.7
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 84.32
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 84.31
PF13013109 F-box-like_2: F-box-like domain 84.22
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 83.86
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 83.31
PRK15386 426 type III secretion protein GogB; Provisional 82.84
smart0036726 LRR_CC Leucine-rich repeat - CC (cysteine-containi 82.77
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 81.33
KOG3864221 consensus Uncharacterized conserved protein [Funct 81.27
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information 
Probab=99.78  E-value=3.8e-21  Score=174.26  Aligned_cols=361  Identities=18%  Similarity=0.185  Sum_probs=236.5

Q ss_pred             CCCchHHHHHHhcCCChhhhhhccccchhHHHH------hccCCceeecccchhhhhhccccchhhhhHHHHHHHHHHhc
Q 013295           12 SCLPNAILCHILSFLPTKYAVATCVLSSTWKLV------WTSLPNLCFDDRLCLEFQRNLDLSTVASTRFENFVHRVLLS   85 (446)
Q Consensus        12 s~LPdelL~~Ils~L~~~~~~r~s~vsrrWr~l------w~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~l~~   85 (446)
                      -.||.|++..|||+|+++..++++++|+.|..+      |..+..+.|..+.-.                 ..|.....+
T Consensus        73 ~~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~AlD~~~~q~idL~t~~rDv~g-----------------~VV~~~~~R  135 (483)
T KOG4341|consen   73 RSLPPELLLKVFSMLDTKSLCRAAQCCTMWNKLALDGSCWQHIDLFTFQRDVDG-----------------GVVENMISR  135 (483)
T ss_pred             ccCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhhhhccccceeeehhcchhcCCC-----------------cceehHhhh
Confidence            369999999999999999999999999999853      555443333322111                 123344444


Q ss_pred             CCCCcceEEEEecccCCcccHHHHHHHHHhCCceEEEEEecCCccccCCCccc-ccCcccEEEecceecc-cC---CCcc
Q 013295           86 ASGNINKFSLRCCGLVDSSRLKLWVSFATMRNVREIEISLNDDECIELPHCIY-TCKTLEVLKLDMNFFI-KT---PPTI  160 (446)
Q Consensus        86 ~~~~v~~l~l~~~~~~~~~~~~~wi~~~~~~~l~~L~l~~~~~~~~~lp~~l~-~~~~L~~L~L~~~~~~-~~---~~~~  160 (446)
                      .++.++.++++.........+.....  .++++++|.+..+.......-.++. .|++|++|.|.+|..- +.   .-+.
T Consensus       136 cgg~lk~LSlrG~r~v~~sslrt~~~--~CpnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~  213 (483)
T KOG4341|consen  136 CGGFLKELSLRGCRAVGDSSLRTFAS--NCPNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAE  213 (483)
T ss_pred             hccccccccccccccCCcchhhHHhh--hCCchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHH
Confidence            44889999999887555444443332  4568888877665421111111222 3999999999997532 21   1344


Q ss_pred             CCCCccEEEeeeEEec-cchHHHHhccCCCcceEEEEeeEeCCCCceE-EE--eccCcceEEEeeccCcccccCceEEEE
Q 013295          161 FFPSAKILHVILNTID-NNFSDWLFSKCPALEDLSIKGYIYGTDSVTL-NI--PSLTLKRLRLELEAPEEDYITKYKVII  236 (446)
Q Consensus       161 ~l~~L~~L~L~~~~~~-~~~l~~ll~~cp~Le~L~L~~~~~~~~~~~~-~i--~~~~L~~L~i~~~~~~~~~~~~~~~~~  236 (446)
                      +|++|++|++++|.-. ..+++.+..+|..|+++.+.||.-.+. +.+ .+  .++-+.++++..|....+ .....+.-
T Consensus       214 gC~kL~~lNlSwc~qi~~~gv~~~~rG~~~l~~~~~kGC~e~~l-e~l~~~~~~~~~i~~lnl~~c~~lTD-~~~~~i~~  291 (483)
T KOG4341|consen  214 GCRKLKYLNLSWCPQISGNGVQALQRGCKELEKLSLKGCLELEL-EALLKAAAYCLEILKLNLQHCNQLTD-EDLWLIAC  291 (483)
T ss_pred             hhhhHHHhhhccCchhhcCcchHHhccchhhhhhhhcccccccH-HHHHHHhccChHhhccchhhhccccc-hHHHHHhh
Confidence            8999999999999866 788999999999999999999863333 222 11  234566666556632211 00111111


Q ss_pred             ecccceeEEeeccCCcceEEeCCCCceEEEEEEeeeeecCCCCchhhHHHHHHHHhcCCCeeEEEEeCCccccccccccc
Q 013295          237 RAPNLEQLYIRDHGPGLYVVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSSGTMFALDRLDYA  316 (446)
Q Consensus       237 ~~p~L~~L~l~~~~~~~~~~~~~~~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~L~~~~~~~~~~~~~~  316 (446)
                      .+-.|+.++++++.                              ...+.....+.+.+++|+.|.+.....-  .  +. 
T Consensus       292 ~c~~lq~l~~s~~t------------------------------~~~d~~l~aLg~~~~~L~~l~l~~c~~f--s--d~-  336 (483)
T KOG4341|consen  292 GCHALQVLCYSSCT------------------------------DITDEVLWALGQHCHNLQVLELSGCQQF--S--DR-  336 (483)
T ss_pred             hhhHhhhhcccCCC------------------------------CCchHHHHHHhcCCCceEEEeccccchh--h--hh-
Confidence            23344444444332                              1222355677778899999998876431  1  10 


Q ss_pred             cCCC-CCCCCccceEEEEecccccHHHHHHHHhhCCCCceEEEecccCCCCCCCcc--cccccccceeEEEEEEeeCchh
Q 013295          317 NDHS-FPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSL--ALGCLLSHVKIIVIGEFEGEEN  393 (446)
Q Consensus       317 ~~~~-~~~~~~L~~L~L~~~~~~~~~~l~~ll~~~p~L~~L~i~~~~~~~~~~~~~--~~~~~~~~L~~v~i~~~~g~~~  393 (446)
                      .... -..++.|+.|++.-+....+..+..+-.+||.||+|.++.|....-+++..  ...|-..+|..+++.+..+.+ 
T Consensus       337 ~ft~l~rn~~~Le~l~~e~~~~~~d~tL~sls~~C~~lr~lslshce~itD~gi~~l~~~~c~~~~l~~lEL~n~p~i~-  415 (483)
T KOG4341|consen  337 GFTMLGRNCPHLERLDLEECGLITDGTLASLSRNCPRLRVLSLSHCELITDEGIRHLSSSSCSLEGLEVLELDNCPLIT-  415 (483)
T ss_pred             hhhhhhcCChhhhhhcccccceehhhhHhhhccCCchhccCChhhhhhhhhhhhhhhhhccccccccceeeecCCCCch-
Confidence            1111 236789999999988876666799999999999999999876222222222  345778899999999887764 


Q ss_pred             HHHHHHHHHhhccccCeEEEEcccccCCCcHHHHHHHH
Q 013295          394 EMKLIKYLLKNGEVLNAMIIGGEQFQRRGSKEEVYEQI  431 (446)
Q Consensus       394 ~~~~~~~ll~~a~~L~~l~i~~~~~~~~~~~~~~~~~l  431 (446)
                       .+..+++ .++++||++.++..+...++..++...++
T Consensus       416 -d~~Le~l-~~c~~Leri~l~~~q~vtk~~i~~~~~~l  451 (483)
T KOG4341|consen  416 -DATLEHL-SICRNLERIELIDCQDVTKEAISRFATHL  451 (483)
T ss_pred             -HHHHHHH-hhCcccceeeeechhhhhhhhhHHHHhhC
Confidence             3566776 78899999999999887777666666654

>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00579 FBD domain in FBox and BRCT domain containing plant proteins Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF08387 FBD: FBD; InterPro: IPR013596 This region is found in F-box (IPR001810 from INTERPRO) and other domain containing plant proteins; it is repeated in two family members Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>smart00256 FBOX A Receptor for Ubiquitination Targets Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF07723 LRR_2: Leucine Rich Repeat; InterPro: IPR013101 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2997 consensus F-box protein FBX9 [General function prediction only] Back     alignment and domain information
>PLN03215 ascorbic acid mannose pathway regulator 1; Provisional Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0274 consensus Cdc4 and related F-box and WD-40 proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>PF13013 F-box-like_2: F-box-like domain Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query446
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 3e-05
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 2e-04
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 71.4 bits (174), Expect = 3e-13
 Identities = 74/462 (16%), Positives = 150/462 (32%), Gaps = 144/462 (31%)

Query: 45  WTSLPNLCFDDRLCLEFQRNL------------DLSTVASTRFENFVHRV---------- 82
           W +L N C      LE  + L            D S+    R  +    +          
Sbjct: 186 WLNLKN-CNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYE 244

Query: 83  --LL-----SASGNINKFSLRCCGLV---DSSRLKLWVSFATMRNVREIEIS--LNDDEC 130
             LL       +   N F+L C  L+       +  ++S AT  ++     S  L  DE 
Sbjct: 245 NCLLVLLNVQNAKAWNAFNLSCKILLTTRFKQ-VTDFLSAATTTHISLDHHSMTLTPDE- 302

Query: 131 IELPHCIYTCKTLEVL--KLDMNFF------IKTPP---TIFFPSAKILHVILNTIDNNF 179
                         +L   LD          + T P   +I    A+ +   L T DN  
Sbjct: 303 -----------VKSLLLKYLDCRPQDLPREVLTTNPRRLSII---AESIRDGLATWDN-- 346

Query: 180 SDWLFSKCPALE---DLSIKG---------Y----IYGTDSVTLNIPSLTLKRLRLELEA 223
             W    C  L    + S+           +    ++   +   +IP++ L  +  ++  
Sbjct: 347 --WKHVNCDKLTTIIESSLNVLEPAEYRKMFDRLSVFPPSA---HIPTILLSLIWFDVIK 401

Query: 224 PEEDYIT----KYKVIIRAPNLEQLYIRDHGPGLYV--------VHELHSLTKAVVD-YG 270
            +   +     KY ++ + P    + I    P +Y+         + LH   +++VD Y 
Sbjct: 402 SDVMVVVNKLHKYSLVEKQPKESTISI----PSIYLELKVKLENEYALH---RSIVDHYN 454

Query: 271 IECILDYDSPEDVAQAVVDM---------LRDIKNIKSLSLSSGTMFALDRLDYANDHSF 321
           I    D D   D+    +D          L++I++ +           L R+ + +    
Sbjct: 455 IPKTFDSD---DLIPPYLDQYFYSHIGHHLKNIEHPE--------RMTLFRMVFLD---- 499

Query: 322 PTFPFL-NRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGVDFEWPEPSLALGCLLSHV 380
             F FL  ++  +        S+ +   ++   +  + +    +E    ++ L  L    
Sbjct: 500 --FRFLEQKIRHDSTAWNASGSILNTLQQLKFYKPYICDNDPKYERLVNAI-LDFLPKIE 556

Query: 381 KIIVIGEFEGEENEMKLIKYLL--KNGEVLNAMIIGGEQFQR 420
           + ++  ++        L++  L  ++  +        +Q QR
Sbjct: 557 ENLICSKY------TDLLRIALMAEDEAIFEE---AHKQVQR 589
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.88
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.87
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.8
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.32
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 99.28
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.25
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.25
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.22
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.2
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.19
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.19
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.15
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.15
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.14
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.11
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.1
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.1
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.1
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.1
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.09
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.09
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.08
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.04
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.03
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.03
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.02
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.02
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.01
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.01
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.01
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.0
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.99
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.99
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.99
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 98.98
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.98
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.98
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.98
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.96
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.95
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 98.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.94
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.93
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.9
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.89
1fs1_A53 SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L 98.88
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.86
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.85
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.84
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.84
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.84
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.83
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.8
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.79
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.78
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.78
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.77
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.76
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.75
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.74
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.72
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.71
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.7
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.69
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.67
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.66
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.64
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.62
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 98.61
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.59
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.58
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.55
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.55
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.5
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.48
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.44
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.43
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.41
3m19_A251 Variable lymphocyte receptor A diversity region; a 98.4
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.37
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.33
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.32
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.31
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.25
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.23
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.19
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.18
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.16
3e6j_A229 Variable lymphocyte receptor diversity region; var 98.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.13
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.13
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.12
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 98.11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.08
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 98.07
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.03
2e31_A297 FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui 98.03
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 98.03
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.02
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 97.91
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 97.91
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.86
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.84
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.83
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.76
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.76
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 97.7
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.65
1w8a_A192 SLIT protein; signaling protein, secreted protein, 97.59
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.59
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.48
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.48
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.47
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.46
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.44
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.36
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.34
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.33
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 97.3
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.28
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 97.23
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.21
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.2
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 97.06
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.68
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 96.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.06
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 95.8
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 95.22
4fdw_A401 Leucine rich hypothetical protein; putative cell s 93.77
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 93.41
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 83.12
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 81.01
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 80.06
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
Probab=99.88  E-value=4.7e-23  Score=210.02  Aligned_cols=373  Identities=10%  Similarity=0.020  Sum_probs=183.2

Q ss_pred             CCCcCC----CCchHHHHHHhcCC-ChhhhhhccccchhHHHHhccCCc-eeecccchhhhhhccccchhhhhHHHHHHH
Q 013295            7 TEDRIS----CLPNAILCHILSFL-PTKYAVATCVLSSTWKLVWTSLPN-LCFDDRLCLEFQRNLDLSTVASTRFENFVH   80 (446)
Q Consensus         7 ~~d~is----~LPdelL~~Ils~L-~~~~~~r~s~vsrrWr~lw~~~~~-l~~~~~~~~~~~~~~~~~~~~~~~~~~~v~   80 (446)
                      +.|+++    +||||++.+||+|| +.+|++++++|||||++++...+. +.+.. .+...                 ..
T Consensus         5 ~~~r~~~~~~~LPdeil~~I~~~L~~~~d~~~~s~vck~W~~~~~~~~~~l~~~~-~~~~~-----------------~~   66 (592)
T 3ogk_B            5 DIKRCKLSCVATVDDVIEQVMTYITDPKDRDSASLVCRRWFKIDSETREHVTMAL-CYTAT-----------------PD   66 (592)
T ss_dssp             -------CCCCCGGGTHHHHHTTCCCHHHHHHHTTSCHHHHHHHHHHCCEEEESC-GGGSC-----------------HH
T ss_pred             hhhhHhhccCCCCHHHHHHHHHhcCCHHHHHHHHHHhHHHHHhhhccccEEEEee-ccccC-----------------hH
Confidence            456666    89999999999999 899999999999999988644331 22111 11100                 01


Q ss_pred             HHHhcCCCCcceEEEEeccc---------CCcccHHHHHHHHH--hCCceEEEEEecCC---------------------
Q 013295           81 RVLLSASGNINKFSLRCCGL---------VDSSRLKLWVSFAT--MRNVREIEISLNDD---------------------  128 (446)
Q Consensus        81 ~~l~~~~~~v~~l~l~~~~~---------~~~~~~~~wi~~~~--~~~l~~L~l~~~~~---------------------  128 (446)
                      .++ .+-+.++++.++.+..         ........|+....  .+++++|+|+.+..                     
T Consensus        67 ~~~-~~~~~L~~L~L~~~~~~~~~~~~~~~~~~~~~~~l~~l~~~~~~L~~L~L~~~~i~~~~~~~l~~~~~~~L~~L~L  145 (592)
T 3ogk_B           67 RLS-RRFPNLRSLKLKGKPRAAMFNLIPENWGGYVTPWVTEISNNLRQLKSVHFRRMIVSDLDLDRLAKARADDLETLKL  145 (592)
T ss_dssp             HHH-HHCTTCSEEEEECSCGGGGGTCSCTTSCCBCHHHHHHHHHHCTTCCEEEEESCBCCHHHHHHHHHHHGGGCCEEEE
T ss_pred             HHH-HhCCCCeEEEecCCcchhhcccccccccccchHHHHHHHhhCCCCCeEEeeccEecHHHHHHHHHhccccCcEEEC
Confidence            111 1113355555544321         11222334444332  23455555543311                     


Q ss_pred             ------ccccCCCcccccCcccEEEecceecccCC------CccCCCCccEEEeeeEEec---cchHHHHhccCCCcceE
Q 013295          129 ------ECIELPHCIYTCKTLEVLKLDMNFFIKTP------PTIFFPSAKILHVILNTID---NNFSDWLFSKCPALEDL  193 (446)
Q Consensus       129 ------~~~~lp~~l~~~~~L~~L~L~~~~~~~~~------~~~~l~~L~~L~L~~~~~~---~~~l~~ll~~cp~Le~L  193 (446)
                            ....++.....|++|++|+|.+|.+.+..      ....+++|++|+|+++.+.   ...+..++.+||+|+.|
T Consensus       146 ~~~~~~~~~~l~~~~~~~~~L~~L~L~~~~~~~~~~~~l~~~~~~~~~L~~L~L~~n~~~~~~~~~l~~~~~~~~~L~~L  225 (592)
T 3ogk_B          146 DKCSGFTTDGLLSIVTHCRKIKTLLMEESSFSEKDGKWLHELAQHNTSLEVLNFYMTEFAKISPKDLETIARNCRSLVSV  225 (592)
T ss_dssp             ESCEEEEHHHHHHHHHHCTTCSEEECTTCEEECCCSHHHHHHHHHCCCCCEEECTTCCCSSCCHHHHHHHHHHCTTCCEE
T ss_pred             cCCCCcCHHHHHHHHhhCCCCCEEECccccccCcchhHHHHHHhcCCCccEEEeeccCCCccCHHHHHHHHhhCCCCcEE
Confidence                  00111111224555666666555543311      1124556666666555553   34555556666666666


Q ss_pred             EEEeeEeCCCCceEEEeccCcceEEEeeccCccc-----------------------ccCceEEEEecccceeEEeeccC
Q 013295          194 SIKGYIYGTDSVTLNIPSLTLKRLRLELEAPEED-----------------------YITKYKVIIRAPNLEQLYIRDHG  250 (446)
Q Consensus       194 ~L~~~~~~~~~~~~~i~~~~L~~L~i~~~~~~~~-----------------------~~~~~~~~~~~p~L~~L~l~~~~  250 (446)
                      .+.+|...++ ...-...++|+.|.+..+.....                       ......+...+++|++|++.++.
T Consensus       226 ~L~~~~~~~l-~~~~~~~~~L~~L~l~~~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~l~~~~~~~~~L~~L~Ls~~~  304 (592)
T 3ogk_B          226 KVGDFEILEL-VGFFKAAANLEEFCGGSLNEDIGMPEKYMNLVFPRKLCRLGLSYMGPNEMPILFPFAAQIRKLDLLYAL  304 (592)
T ss_dssp             ECSSCBGGGG-HHHHHHCTTCCEEEECBCCCCTTCTTSSSCCCCCTTCCEEEETTCCTTTGGGGGGGGGGCCEEEETTCC
T ss_pred             eccCccHHHH-HHHHhhhhHHHhhcccccccccchHHHHHHhhccccccccCccccchhHHHHHHhhcCCCcEEecCCCc
Confidence            6666543322 11111124444444442111000                       00000111134567777776655


Q ss_pred             Ccce----EEeCCCCceEEEEEEeeeeecCCCCchhhHHHHHHHHhcCCCeeEEEEeC-----------Ccccccccccc
Q 013295          251 PGLY----VVHELHSLTKAVVDYGIECILDYDSPEDVAQAVVDMLRDIKNIKSLSLSS-----------GTMFALDRLDY  315 (446)
Q Consensus       251 ~~~~----~~~~~~~L~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~l~~l~~L~L~~-----------~~~~~~~~~~~  315 (446)
                      ....    .+..+++|+.+++..           ......+..++..+++|++|.++.           +.+....   .
T Consensus       305 l~~~~~~~~~~~~~~L~~L~L~~-----------~~~~~~l~~~~~~~~~L~~L~L~~g~~~~~~~~~~~~~~~~~---~  370 (592)
T 3ogk_B          305 LETEDHCTLIQKCPNLEVLETRN-----------VIGDRGLEVLAQYCKQLKRLRIERGADEQGMEDEEGLVSQRG---L  370 (592)
T ss_dssp             CCHHHHHHHHTTCTTCCEEEEEG-----------GGHHHHHHHHHHHCTTCCEEEEECCCCSSTTSSTTCCCCHHH---H
T ss_pred             CCHHHHHHHHHhCcCCCEEeccC-----------ccCHHHHHHHHHhCCCCCEEEeecCccccccccccCccCHHH---H
Confidence            3221    135667777776651           223344555666777788887772           1111000   0


Q ss_pred             ccCCCCCCCCccceEEEEecccccHHHHHHHHhhCCCCceEEEeccc-CCCCCCC-cc--cc--cccccceeEEEEEEee
Q 013295          316 ANDHSFPTFPFLNRLEVEGVGACGWLSLAHIFSRMPKLESIVFEEGV-DFEWPEP-SL--AL--GCLLSHVKIIVIGEFE  389 (446)
Q Consensus       316 ~~~~~~~~~~~L~~L~L~~~~~~~~~~l~~ll~~~p~L~~L~i~~~~-~~~~~~~-~~--~~--~~~~~~L~~v~i~~~~  389 (446)
                        ......+++|++|++..+ ......+..+...||+|+.|++..++ .....+. .+  ..  -...++|+.+.+..+.
T Consensus       371 --~~l~~~~~~L~~L~l~~~-~l~~~~~~~l~~~~~~L~~L~l~~~~~~n~l~~~p~~~~~~~~~~~~~~L~~L~L~~~~  447 (592)
T 3ogk_B          371 --IALAQGCQELEYMAVYVS-DITNESLESIGTYLKNLCDFRLVLLDREERITDLPLDNGVRSLLIGCKKLRRFAFYLRQ  447 (592)
T ss_dssp             --HHHHHHCTTCSEEEEEES-CCCHHHHHHHHHHCCSCCEEEEEECSCCSCCSSCCCHHHHHHHHHHCTTCCEEEEECCG
T ss_pred             --HHHHhhCccCeEEEeecC-CccHHHHHHHHhhCCCCcEEEEeecCCCccccCchHHHHHHHHHHhCCCCCEEEEecCC
Confidence              000123677888887433 33666666777778888888887532 1111110 00  00  1124678888886544


Q ss_pred             CchhHHHHHHHHHhhccccCeEEEEccc
Q 013295          390 GEENEMKLIKYLLKNGEVLNAMIIGGEQ  417 (446)
Q Consensus       390 g~~~~~~~~~~ll~~a~~L~~l~i~~~~  417 (446)
                      |.-. ......+.+.+++|+.+.+....
T Consensus       448 ~~l~-~~~~~~~~~~~~~L~~L~L~~n~  474 (592)
T 3ogk_B          448 GGLT-DLGLSYIGQYSPNVRWMLLGYVG  474 (592)
T ss_dssp             GGCC-HHHHHHHHHSCTTCCEEEECSCC
T ss_pred             CCcc-HHHHHHHHHhCccceEeeccCCC
Confidence            4211 23445666778889998887554
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 446
d2ovrb1102 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing 7e-06
d1nexb1100 a.158.1.1 (B:270-369) Cdc4 F-box and linker domain 3e-05
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

class: All alpha proteins
fold: F-box domain
superfamily: F-box domain
family: F-box domain
domain: F-box/WD repeat-containing protein 7, FBXW7
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 42.4 bits (99), Expect = 7e-06
 Identities = 16/63 (25%), Positives = 23/63 (36%), Gaps = 11/63 (17%)

Query: 9  DRISCLPNAILCHILSFLPTKYAVATCVLSSTWKLVWTSLPNLCFDD----RLCLEFQRN 64
          D IS LP  +  ++LSFL  K  +        W+        L  D+      C E   +
Sbjct: 17 DFISLLPKELALYVLSFLEPKDLLQAAQTCRYWR-------ILAEDNLLWREKCKEEGID 69

Query: 65 LDL 67
            L
Sbjct: 70 EPL 72
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query446
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.2
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.14
d1fs1a141 Skp2 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.79
d2ovrb1102 F-box/WD repeat-containing protein 7, FBXW7 {Human 98.77
d1nexb1100 Cdc4 F-box and linker domains {Baker's yeast (Sacc 98.75
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.68
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.66
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.63
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.6
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.57
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.53
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.52
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.52
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.5
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.47
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.44
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.43
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.36
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.34
d1p22a1118 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 98.33
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.27
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.25
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.24
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.16
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.16
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.07
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.95
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 97.93
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 97.84
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 97.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.62
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.57
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 97.51
d2ifga3156 High affinity nerve growth factor receptor, N-term 97.22
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.16
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.14
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 96.11
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.05
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.56
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.38
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 93.01
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 92.4
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 92.16
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: RNI-like
family: Cyclin A/CDK2-associated p19, Skp2
domain: Cyclin A/CDK2-associated p19, Skp2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.20  E-value=2.7e-13  Score=122.18  Aligned_cols=83  Identities=13%  Similarity=0.001  Sum_probs=46.8

Q ss_pred             ccCcccEEEecceecccC---CCccCCCCccEEEeeeEEeccchHHHHhccCCCcceEEEEeeEeCC---CCceEEEecc
Q 013295          139 TCKTLEVLKLDMNFFIKT---PPTIFFPSAKILHVILNTIDNNFSDWLFSKCPALEDLSIKGYIYGT---DSVTLNIPSL  212 (446)
Q Consensus       139 ~~~~L~~L~L~~~~~~~~---~~~~~l~~L~~L~L~~~~~~~~~l~~ll~~cp~Le~L~L~~~~~~~---~~~~~~i~~~  212 (446)
                      ...+|++|++++|.+...   .-+..|++|++|+|.++.+.+..+.. +..||+|+.|++.+|..-+   + ..+.-.++
T Consensus        44 ~~~~L~~LdLs~~~i~~~~l~~l~~~c~~L~~L~L~~~~l~~~~~~~-l~~~~~L~~L~Ls~c~~itd~~l-~~l~~~~~  121 (284)
T d2astb2          44 SPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNT-LAKNSNLVRLNLSGCSGFSEFAL-QTLLSSCS  121 (284)
T ss_dssp             CCBCCCEEECTTCEECHHHHHHHHTTBCCCSEEECTTCBCCHHHHHH-HTTCTTCSEEECTTCBSCCHHHH-HHHHHHCT
T ss_pred             cCCCCCEEECCCCccCHHHHHHHHHhCCCcccccccccCCCcHHHHH-HhcCCCCcCcccccccccccccc-chhhHHHH
Confidence            455777777777665431   11335677777777777666444443 4567777777777654111   1 11111246


Q ss_pred             CcceEEEeecc
Q 013295          213 TLKRLRLELEA  223 (446)
Q Consensus       213 ~L~~L~i~~~~  223 (446)
                      +|++|++++|.
T Consensus       122 ~L~~L~ls~c~  132 (284)
T d2astb2         122 RLDELNLSWCF  132 (284)
T ss_dssp             TCCEEECCCCT
T ss_pred             hcccccccccc
Confidence            66666666653
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure