Citrus Sinensis ID: 013362

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----

MRPAASFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFERDNDTKSEKLDPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLALSTPESESNIEDETTTSDLRSEDDTVHIDCAVNTSPGTSEVIISAALYLKLRRYPDQQDDGREKYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHPKADNSKDIILTDSNMEVDVSLNT

cccccccccccccEEEEEcccccHHHHccccccEEEEEcccccccccccccHHHHHHHcccccccccccccccccccccccEEEECccccEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccccccccccccHHHHHHcccEEEEEccccEEEEEcccccccccccccccCECcccccccccccEEEccccccccccccccEEEcccccCEEEEEEEEcccccHHHHccccccEEEEEccccEEEEccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEEEEccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHccccccccEEEEEEEEEEEEcccccccccccccEEECcccEEEEEEEcc

*****SFYHKDDDCLYIVDSENHAIRRADMGRRVLETVYPTSGISKKNNSLWAWIMEKLGFE**********DPQSLIFPWHLMKSEDDNLLIINRSFETLWIMDLASGEIKEAVKGFSKVLEICGVLVMEKVFLLKQMPQDWLLHQIDSSCSLKELPYAGLISSSIAFQNHILLCDIVGQRIMRLNRESGVCSNFQFSNFAILGLPYWFAFPLERVYAVAGGHQGSWTDHIQRCSLLPGRIDIKVNVDIPSDTELVESLQEGCIWRQARGTASVVLRAEDVAGSLEKVGVAQLWYDELDTLAL************************VHIDCAVNTSPGTSEVIISAALYLKLRRYP********KYAARISDILKLGRSGAMQRDSFIRFLLKSNQDLRDVIFVKPLHVSIQFDTLDHP**DNSKDIILTDSNMEVDVSLN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KYA, chain A
Confidence level:confident
Coverage over the Query: 1-66,77-135,152-240
View the alignment between query and template
View the model in PyMOL

Template: 2P4O, chain A
Confidence level:confident
Coverage over the Query: 2-42,78-121,156-272
View the alignment between query and template
View the model in PyMOL

Template: 3QQZ, chain A
Confidence level:probable
Coverage over the Query: 2-42,60,77-217
View the alignment between query and template
View the model in PyMOL