Citrus Sinensis ID: 013376

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----

MGGCVSTSSRSTCSSRSNGETVSPIYGCCGQKRTKRTFSDHVITMHNLPSVPHRIFMNGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARRVRDALPIKLLSFLLASQSRQNGPGKTCFNGNTKKLEAGDSEKDGPAEDKSNSLWREAYLKAYKSMDKELKSHPNLDCFCSGSTAVTIVKQVWQGALHSLHLQFGEAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSHRLLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRSSAARILVDAAAREWKLKYPTSKMDDCAVVCLFLDGKMDLESDYEEQGFSSATIQSNHSGNAIESDDGQKSEPSLQRNFTVRSSDESDTYGRLVVEDDGNGETFPGEDQNWSGLEGVTRVNSLVQLPRFSEERPNP

cccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccEEEEEEccccccccccEEEEEccccccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEEcccccEEcccccccHHHHHHHcccEEEEccccccccEEEcccccccccHHHccccccccccccEEEccCEEEEEccccccEEEEEcccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**********************************************NLPSVPHRIFMNGKSRTSCIFTQQGRKGINQDAMIVWEDFMSEDVTFCGVFDGHGPHGHLVARRVRDALPIKLLSFLLASQSRQNGPGKTCFNGNTKKLEA********AEDKSNSLWREAYLKAYKSMDKELKSHPNLDCFCSGSTAVTIVKQVWQGALHSLHLQFGEAERIKRCKGRVFALQDEPEVPRVWLPFDDAPGLAMARAFGDFCLKEYGVISIPEFSHRLLTDRDQFIVLASDGVWDVLSNEEVVEIVSSAPTRSSAARILVDAAAREWKLKYPTSKMDDCAVVCLFLDG********************************************************************************VTRVNSLVQ***********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable protein phosphatase 2C 64		probable	Q8H4S6
Probable protein phosphatase 2C 52		probable	Q8GY60

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I44, chain A
Confidence level:very confident
Coverage over the Query: 63-140,153-343
View the alignment between query and template
View the model in PyMOL

Template: 2PNQ, chain A
Confidence level:very confident
Coverage over the Query: 63-344
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3qn1, chain B		confident	Alignment \| Template Structure