Citrus Sinensis ID: 013397

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440----

MKKWYGGVLIASLFMLLLLRYGFMKNPIGESYLTSLISSNASNPLEWTHTAAAPGVQDPENSSQVISIDAITFGLFAQRNISKEEQQSLLTWNLLKQLINHSQVLSNGVEAIKEAGSAWNNLMASVEEEKLGYTNRSSVRKAKEKQCPHFLNKMNTTDLDRSSFKLQVPCGLTQGSSITIIGIPNGLLGNFRIDLTGEPLPGEPDPPIVLHYNVRLLGDKITENPVIVQNTWTLAHDWGEEVRCPSPSPEKIIKVDELDQCNKLVGNDDKRLPTVSTRLNNSRTSKTKRFFPFKQGHLFVATIRVGSEGIQTTVDGKHITSFAYRETLEPWLVNEVRISGDLKLISVLASGLPTSEDSEHTTDLEALRSYPLSLHKPVDLFIGVFSTANNFKRRMAVRRTWMQYTEVRSGTVAVRFFVGLVSFTEPYLLLLWYTIIMWDRSVVD

ccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccEEEECcccccccEEEEEECccccccEEEEEcccccccccccccEEEEEEccccccccccccEEEEEccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEEccCEEEEEEccCEEEEEccccccccccEEEEEEEccEEEEEEEcccccccccccHHHHHHHHHccccccccccEEEEEEEcccccHHHHHHHHHHHccccccccccEEEEEEEEEccccHHHHHHHHHHHHHHcccccc

***WYGGVLIASLFMLLLLRYGFMKNPIGESYLTSLI*******L*******************VISIDAITFGLFAQRNISKEEQQSLLTWNLLKQLINHSQVLSNGVEAIKEAGSAWNNLMAS************************FLN***TTDLDRSSFKLQVPCGLTQGSSITIIGIPNGLLGNFRIDLTGEPLPGEPDPPIVLHYNVRLLGDKITENPVIVQNTWTLAHDWGEEVRC*******IIKVDELDQCNKLV**********************KRFFPFKQGHLFVATIRVGSEGIQTTVDGKHITSFAYRETLEPWLVNEVRISGDLKLISVLASGLPTSEDSEHTT**EALRSYPLSLHKPVDLFIGVFSTANNFKRRMAVRRTWMQYTEVRSGTVAVRFFVGLVSFTEPYLLLLWYTIIMWDRSVVD

xxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Beta-1,3-galactosyltransferase 15	Beta-1,3-galactosyltransferase that transfers galactose from UDP-galactose to substrates with a terminal beta-N-acetylglucosamine (beta-GlcNAc) residue. Involved in the biosynthesis of N-glycans containing Lewis a structures (with the combination of FUT13).	probable	Q8L7F9

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSU, chain A
Confidence level:very confident
Coverage over the Query: 160-244,289-422
View the alignment between query and template
View the model in PyMOL