Citrus Sinensis ID: 013414

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MASIRRTMSPVPRAGTFLNGEACQVASPLSKSSSCTQNHPASSGGLLSYLHSSLDSQALIFGVSSPRSSRPLERARPKAQVWRRALFHFLICFVVGVFIGLTPFVSMNLSTNLMSKQQALTFEMVYAFGNSQTYDGMARNVTVDNDGIKNNATLESQAEIRELRDVLSDDYSDNQSLPQDSDLVSRKLIIIVTPTDAQPFQAYYLNRLAHTLRMVQPPLLWIVVEMTSQSEETADVLRRTGVMYRHLVCKKNLTDVKDTRVHQRNVALSHIENHHLDGIVYFADENNIYLTDLFEELRQIRRFGTWTVGKLSENKMDTILEGPICNGTRVIGWHVNEPRERFRRFHAEMSGFAFNSTILWDPKRWHRPTLEPIRQVVTVKDGFQASTFVEQIVEDESQMEGLLEECSRIMAWLLPLESSNAFYPQKWFLKNNLDVMAPLARSS

ccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccEEEcccccccccccccEEEEcccccccccccccHHHHHHHHHHHcccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEccccccEEEEcEEEcccEEEEEEEccccccccccccccccEEEEEccccccccccccccccccccccccccccHHHHHHHHccccccEEEccccccEEEEEEcccccccccccccccccccCEEEEcccccc

****************************************************SLDSQALIFGV****************QVWRRALFHFLICFVVGVFIGLTPFVSMNLSTNL*****ALTFEMV*****SQ***GMARNVTVDN*************************************LVSRKLIIIVTPTDAQPFQAYYLNRLAHTLRMVQPPLLWIVVEMTSQSEETADVLRRTGVMYRHLVCKKNLTDVKDTRVHQRNVALSHIENHHLDGIVYFADENNIYLTDLFEELRQIRRFGTWTVGKLSENKMDTILEGPICNGTRVIGWHVNEPRERFRRFHAEMSGFAFNSTILWDPKRWHRPTLEPIRQVVTVKDGFQASTFVEQIVEDESQMEGLLEECSRIMAWLLPLESSNAFYPQKWFLKNNLDVMAPLA***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable beta-1,4-xylosyltransferase IRX9H	Involved in the synthesis of the hemicellulose glucuronoxylan, a major component of secondary cell walls. Probably involved in the elongation of glucuronoxylan xylosyl backbone.	probable	Q9SXC4
Probable glucuronosyltransferase Os01g0675500	Involved in the synthesis of glucuronoxylan hemicellulose in secondary cell walls.	probable	Q5QM25

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CU0, chain A
Confidence level:very confident
Coverage over the Query: 187-437
View the alignment between query and template
View the model in PyMOL