Citrus Sinensis ID: 013415


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MNKTSQQREKRQRMEDDASNHMDLVLVDEFESSPSVKKMRENGHASPSSQSKDSVIEGTSNTNFVTNAERNSLPCLVKIYDCPESELKLNEVFEFVGVLTLDSDVMADKNDQDESSYGFIEDELVHLPPEKVPRLHCLIHRKLDVNDFLHSSPMMEPKPQLVKETRESLLRHLTSILGNDGIAAHLMLLHLLSRVHARIDNVAVGKLSLNLTCLSKESVSVFGNQVRLSVQNLLPFTQCIPLTVNYLNTASLAPKKDYQTNRLIPGVLQLADGSHLIIDETQLETGTLNSTGVENARLLKNLMEFQKVEYNFEYYKMEMIADVQMLILSEGKSNIVPADLVIPFQPSSAASFEVVPAETLEAWRWYLASVRSLPHSIESDMQKVVESDLVAARQADRSLGGQDLSRLLTMGRLMSASFGETSLSLEHWQMVKELERLRRERLK
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccEEEEEEEEEccccccccccccccccccccHHHHcccccccccEEEEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHccCEEEEcccHHHHcccccccccccccccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHHHcEEEEEEccccEEEEEEEcEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHc
***************************************************************FVTNAERNSLPCLVKIYDCPESELKLNEVFEFVGVLTLDSDVM**********YGFIEDELVHLPPEKVPRLHCLIHRKLDVNDFLHSSP******QLVKETRESLLRHLTSILGNDGIAAHLMLLHLLSRVHARIDNVAVGKLSLNLTCLSKESVSVFGNQVRLSVQNLLPFTQCIPLTVNYLNTASLAPKKDYQTNRLIPGVLQLADGSHLIIDETQLETGTLNSTGVENARLLKNLMEFQKVEYNFEYYKMEMIADVQMLILSEGKSNIVPADLVIPFQPSSAASFEVVPAETLEAWRWYLASVRSLPHSIESDMQKVVESDLVAARQA*****GQDLSRLLTMGRLMSASFGETSLSLEHWQMVKELERLRRER**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKTSQQREKRQRMEDDASNHMDLVLVDEFESSPSVKKMRENGHASPSSQSKDSVIEGTSNTNFVTNAERNSLPCLVKIYDCPESELKLNEVFEFVGVLTLDSDVMADKNDQDESSYGFIEDELVHLPPEKVPRLHCLIHRKLDVNDFLHSSPMMEPKPQLVKETRESLLRHLTSILGNDGIAAHLMLLHLLSRVHARIDNVAVGKLSLNLTCLSKESVSVFGNQVRLSVQNLLPFTQCIPLTVNYLNTASLAPKKDYQTNRLIPGVLQLADGSHLIIDETQLETGTLNSTGVENARLLKNLMEFQKVEYNFEYYKMEMIADVQMLILSEGKSNIVPADLVIPFQPSSAASFEVVPAETLEAWRWYLASVRSLPHSIESDMQKVVESDLVAARQADRSLGGQDLSRLLTMGRLMSASFGETSLSLEHWQMVKELERLRRERLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mini-chromosome maintenance complex-binding protein Associated component of the MCM complex that acts as a regulator of DNA replication. Binds to the MCM complex during late S phase and may act by promoting the disassembly of the MCM complex from chromatin. Required for sister chromatid cohesion.probableQ501D5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F9V, chain A
Confidence level:confident
Coverage over the Query: 67-114,129-436
View the alignment between query and template
View the model in PyMOL