Citrus Sinensis ID: 013425


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MSSWELQENFGPSSFINLEGIRMQLETARSMSAGKLSNYNNKAVCFLKMIKNQPLTKSGSGKDVHHFEFEFVSAAIEYEVGDVLEILPSQDPAAVDTFIQRCNLDPDALITVQHKEMKNYLPDIHKNTTEVPIKLRTFVELTMDVTSASPRRYFFEVMSYFATAEHEKERLQYFASPEGRDDLYKYNQKERRTVLEVLEDFPSVQMPIDWLVQLVPPLKTRAFSISSSPLAHPNQVHLTVSVVSWTTPYKRKRTGLCSVWLAGLDPQQGIYIPAWFQKGSLPRPPPSVPLILIGPGTGCAPFRGFVEERAIQSSSGPAAPIIFFFGCRNEDDFLYRELWLSHSLNDGVFSEAKGGGFYVAFSRKQPQKVYVQHKMLEQSQRIWNLLLSKASIYVAGSATKMPSDVWSTFEEIVSKEGEASRDSAANWLKALQRAGRYHVEAWS
cccccccccccccccccccccccEEcccccccccccccccccccEEEEEEEEEECccccccccEEEEEEEEcccccccccccEEEEECcccHHHHHHHHHHHccccccEEEEccccccccccccccccccccccHHHHHHHccccccccccHHHHHHHHHHcccHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHcccccccHHHHHHHccccccccccccccccccccEEEEEEEEEEEEccccccccccccHHHHccccccccEEEEEEEccccccccccccEEEEcccccHHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHHHHcccccccccccEEEEEccccccccHHHHHHHHcHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccc
**SW****NF****FINLEGIRM***********KLSNYNNKAVCFLKMIKNQPLTKSGSGKDVHHFEFEFVSAAIEYEVGDVLEILPSQDPAAVDTFIQRCNLDPDALITVQHKEMKNYLPDIHKNTTEVPIKLRTFVELTMDVTSASPRRYFFEVMSYFATAEHEKERLQYFASPEGRDDLYKYNQKERRTVLEVLEDFPSVQMPIDWLVQLVPPLKTRAFSISSSPLAHPNQVHLTVSVVSWTTPYKRKRTGLCSVWLAGLDPQQGIYIPAWFQKGSLPRPPPSVPLILIGPGTGCAPFRGFVEERAIQSSSGPAAPIIFFFGCRNEDDFLYRELWLSHSLNDGVFSEAKGGGFYVAFSRKQPQKVYVQHKMLEQSQRIWNLLLSKASIYVAGSATKMPSDVWSTFEEIVSKEG*****SAANWLKALQRAGRYHVEAWS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSWELQENFGPSSFINLEGIRMQLETARSMSAGKLSNYNNKAVCFLKMIKNQPLTKSGSGKDVHHFEFEFVSAAIEYEVGDVLEILPSQDPAAVDTFIQRCNLDPDALITVQHKEMKNYLPDIHKNTTEVPIKLRTFVELTMDVTSASPRRYFFEVMSYFATAEHEKERLQYFASPEGRDDLYKYNQKERRTVLEVLEDFPSVQMPIDWLVQLVPPLKTRAFSISSSPLAHPNQVHLTVSVVSWTTPYKRKRTGLCSVWLAGLDPQQGIYIPAWFQKGSLPRPPPSVPLILIGPGTGCAPFRGFVEERAIQSSSGPAAPIIFFFGCRNEDDFLYRELWLSHSLNDGVFSEAKGGGFYVAFSRKQPQKVYVQHKMLEQSQRIWNLLLSKASIYVAGSATKMPSDVWSTFEEIVSKEGEASRDSAANWLKALQRAGRYHVEAWS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADPH-dependent diflavin oxidoreductase ATR3 Oxidoreductase that catalyzes the NADP-dependent reduction of cytochrome c, but not cytochrome P450 in vitro. Required for embryo development. May participate to the control of cell death through its interaction with the DRE2 homolog At5g18400.probableQ6NPS8

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QTL, chain A
Confidence level:very confident
Coverage over the Query: 44-443
View the alignment between query and template
View the model in PyMOL
Template: 3OJW, chain A
Confidence level:confident
Coverage over the Query: 23-443
View the alignment between query and template
View the model in PyMOL