Citrus Sinensis ID: 013431

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---

MTLVPPLALPSHCSRPSLVAQLGSTFRLFSLALCGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCPSQIRGTLISLKELFIVLGILLGYFVGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAISALGKLRRRPPGDKLSERQIEDTLVSLKSSYTDEKSEGSFLEVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEEIESKILK

ccccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccccccccHHcccccccHHHHHHHHHHHHHHHHHcccEEEEccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHc

**LVPPLALPSHCSRPSLVAQLGSTFRLFSLALCGSLYGALLGSILVYSIADFLGRKRELIIAAVLYALGALTTAYAPGLGVLLVGRLLYGLGIGLAMHGAPLYIAETCPSQIRGTLISLKELFIVLGILLGYFVGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAISALGKLRRRPPGDKLSERQIED*****************FLEVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKLVMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQISFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAIAFLAVLFIVRTVPETKGLSLEEIESKI**

xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
D-xylose-proton symporter-like 3, chloroplastic		probable	Q0WWW9
Facilitated trehalose transporter Tret1-2 homolog	Fails to transport trehalose.	probable	Q8MKK4
Putative metabolite transport protein YwtG		probable	C0SPB2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 13-442
View the alignment between query and template
View the model in PyMOL

Template: 4APS, chain A
Confidence level:confident
Coverage over the Query: 20-226,239-410
View the alignment between query and template
View the model in PyMOL