Citrus Sinensis ID: 013441


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440---
MASIVAATPWSRIRTITKLELAPPIFLQSSVYYCKRRRFSVAASLSTNTNKVDGQVRVRFAPSPTGNLHVGGARTALFNYLFARSKGGKFVLRIEDTDLERSTKESEEAVLQDLSWLGLDWDEGPGVGGDYGPYRQSERNSLYKQYADKLLESGHVYRCFCSNEELEKMKEIAKLKQLPPVYTGKWATATDAEVQKELERGTPYTYRFRVPKGGSLKISDLIRGEVSWNLDTLGDFVIMRSNGQPVYNFCVTVDDATMAISHVIRAEEHLPNTLRQALIYKALGFSMPYFAHVSLILAPDRSKLSKRHGATSVGQFREMGYLPQAMVNYLALLGWGDGTENEFFTLKQLVEKFTIERVNKSGAIFDSTKLRWMNGQHLRAIPSNELTKLIGERWKSTGILTESKGPFVDEAIQLLKDGIDLVPDSDKALSNLLSYPLRDTLTR
ccccccccccccEECcccccccccccccccccHHHcccccccccccccccccccccEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHcccccEEEECcccccEEEEcEEEEEEEEEEccccccEEEEccccccccccccccccccccccEEEccccccccHHHHHHHHHHcccccccEEEccccccccccccccccccccHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHccHHHHHHHHcccccccccccccc
****VAATPWSRIRTITKLELAPPIFLQSSVYYCKRRRFSVAASLSTNT**VDGQVRVRFAPSPTGNLHVGGARTALFNYLFARSKGGKFVLRIEDTDLERSTKESEEAVLQDLSWLGLDWDEGPGVGGDYGPYRQSERNSLYKQYADKLLESGHVYRCFCSNEELEKMKEIAKLKQLPPVYTGKWATATDAEVQKELERGTPYTYRFRVPKGGSLKISDLIRGEVSWNLDTLGDFVIMRSNGQPVYNFCVTVDDATMAISHVIRAEEHLPNTLRQALIYKALGFSMPYFAHVSLILAPDRSKLSKRHGATSVGQFREMGYLPQAMVNYLALLGWGDGTENEFFTLKQLVEKFTIERVNKSGAIFDSTKLRWMNGQHLRAIPSNELTKLIGERWKSTGILTESKGPFVDEAIQLLKDGIDLVPDSDKALSNLLSYPLRDT***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASIVAATPWSRIRTITKLELAPPIFLQSSVYYCKRRRFSVAASLSTNTNKVDGQVRVRFAPSPTGNLHVGGARTALFNYLFARSKGGKFVLRIEDTDLERSTKESEEAVLQDLSWLGLDWDEGPGVGGDYGPYRQSERNSLYKQYADKLLESGHVYRCFCSNEELEKMKEIAKLKQLPPVYTGKWATATDAEVQKELERGTPYTYRFRVPKGGSLKISDLIRGEVSWNLDTLGDFVIMRSNGQPVYNFCVTVDDATMAISHVIRAEEHLPNTLRQALIYKALGFSMPYFAHVSLILAPDRSKLSKRHGATSVGQFREMGYLPQAMVNYLALLGWGDGTENEFFTLKQLVEKFTIERVNKSGAIFDSTKLRWMNGQHLRAIPSNELTKLIGERWKSTGILTESKGPFVDEAIQLLKDGIDLVPDSDKALSNLLSYPLRDTLTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutamate--tRNA ligase, chloroplastic/mitochondrial Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).probableQ9FEA2
Glutamate--tRNA ligase Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).probableQ8EYM3
Glutamate--tRNA ligase Catalyzes the attachment of glutamate to tRNA(Glu) in a two-step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end of tRNA(Glu).probableQ250Q8

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
6.-.-.-Ligases.probable
6.1.-.-1D-1-guanidino-3-amino-1,3-dideoxy-scyllo-inositol transaminase.probable
6.1.1.-Ligases forming aminoacyl-tRNA and related compounds.probable
6.1.1.17Glutamate--tRNA ligase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O5R, chain A
Confidence level:very confident
Coverage over the Query: 56-437
View the alignment between query and template
View the model in PyMOL