Citrus Sinensis ID: 013464

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440--
MDADSKAARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFLAKKGGAGGVAGAVVNGSSANGGCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEALCSFISLQELKSVLQNVPEIVELVGSEEANRVLHVEMQDGEEKAKFVLQSIFTNLMTASMEMTTKATTKLKSRLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGANEPHAYISGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYITRYLPPFDEFEVDCCILPKGTSSVFPAVSGPSIFLVTDGEGSMLTASHNDAVAEGDVLFAPANTEINITTSSKLQLYRAGVNSRFLQIV
cccccccccccEEcccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccHHHHHHHccccccEEEEccccccccccccccHHHHHHHccccccccccccccccEEEEccHHHHHcccccHHHHHHHHcccHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccEEEEEEEEEEEccccEEEEccccccccccccEEEEEEcccccHHcccccccccHHHHHcccccccccccccccccccccEEECccccccEEEEEEEEcccccEEcccccccEEEEEEEcEEEEEEcccEEEEccccEEEECccccEEEEEcccEEEEEEEccccccccc
*********RLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFLAKK********************GEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEALCSFISLQELKSVLQNVPEIVELVGSEEANRVLHVEMQDGEEKAKFVLQSIFTNLMTASMEMTTKATTKLKSRLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGANEPHAYISGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYITRYLPPFDEFEVDCCILPKGTSSVFPAVSGPSIFLVTDGEGSMLTASHNDAVAEGDVLFAPANTEINITTSSKLQLYRAGVNSRFLQIV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDADSKAARRLLRLTCSVQKYDWGRTGSDSLVSKLYGLNSGKRTDIDKPYAEFWMGTHESGPSFLAKKGGAGGVAGAVVNGSSANGGCGEIVSLKSWILKNPNVLGDKVLHRWGCDLPFLFKVLSVAKALSIQAHPDKELAKTLHKLLPNVYKDDNHKPEMALAITEFEALCSFISLQELKSVLQNVPEIVELVGSEEANRVLHVEMQDGEEKAKFVLQSIFTNLMTASMEMTTKATTKLKSRLHKESQVRPLTEKEQLVLRLEKQYPADIGVIAAFFFNYVKLNPGQALYLGANEPHAYISGECIECMATSDNVVRAGLTPKHRDVQTLCSMLTYKQGFPEILKGFPLSPYITRYLPPFDEFEVDCCILPKGTSSVFPAVSGPSIFLVTDGEGSMLTASHNDAVAEGDVLFAPANTEINITTSSKLQLYRAGVNSRFLQIV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mannose-6-phosphate isomerase 1 Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions. Involved in the ascorbic acid (AsA) biosynthesis. Required during the endosperm development.probableQ9M884
Probable mannose-6-phosphate isomerase Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.probableQ54PA0
Mannose-6-phosphate isomerase Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.probableQ68FX1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.3.-.-Intramolecular oxidoreductases.probable
5.3.1.-Interconverting aldoses and ketoses, and related compounds.probable
5.3.1.8Mannose-6-phosphate isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PMI, chain A
Confidence level:very confident
Coverage over the Query: 10-68,90-435
View the alignment between query and template
View the model in PyMOL