Citrus Sinensis ID: 013567

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440

MESLAAAAVPLKAKLGVCHQLCFSPFNMKTHSCLLSISSSPLHCQSSRSRFFTASSKLSAARKRDKKISCEFDGKVNGFSSDSGDSRFLDRQRALDAAMNDINSSFGKGSVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKALGVDVENLIVCQPDNGEMALEIADRMCRSGAIDLICVDSVSALTPRAEIEGEIGMQQIGLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLEIRSTGKIKSVKGDEDVGVRVRVRVQKSKVSRPYKQAEFEIIFGEGVSKLGCMLDCAEMMDIVVRKGAWYSYGDQRLGQGRDKALQYLRDNPLLQEEIEKVVRSMMSDGSVHQGSFLRNVSLPNQEENILEEF

cHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccEEEccccccccEEEEcccccHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHHHccccEEEEEccccccHHHHHHHcccccccEEcccccHHHHHHHHHHHHHcccEEEEEEECccccccccccccccccccHHHHHHHHHHHHHHHHcccccccEEEEEEEcHHHHHcccccccccccccccEEEEEEEEEcEEEcccccccccccccccEEEEEEEEccccccccEEEEEEEEcccccccccHHHHHHHcccEEEccccEEEccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccccccccccccccccccc

******AAVPLKAKLGVCHQLCFSPFNMKTHSCLLSISS*********************************************************AAMNDINSSFGKGSVTRLGSAGGALVETFPSGCLTLDLALGGGLPKGRIVEIFGPESSGKTTLALHAIAEVQKLGGNAMLVDAEHAFDPSYSKALGVDVENLIVCQPDNGEMALEIADRMCRSGAIDLICVDSVSALTPRAEIEGEIGMQQIGLQARLMSQALRKMSGNASKAGCTLIFLNQIRYKIGVYYGNPEVTSGGIALKFFASVRLEIRSTGKIKSVKGDEDVGVRVRVRVQKSKVSRPYKQAEFEIIFGEGVSKLGCMLDCAEMMDIVVRKGAWYSYGDQRLGQGRDKALQYLRDNPLLQEEIEKVVRS*****************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA repair protein recA homolog 1, chloroplastic	Involved in recombination ability and DNA strand transfer activity.	confident	Q39199
Protein RecA	Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage.	probable	A9BCQ0
Protein RecA	Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with LexA causing its activation and leading to its autocatalytic cleavage.	probable	Q8G4G9

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CMU, chain A
Confidence level:very confident
Coverage over the Query: 89-418
View the alignment between query and template
View the model in PyMOL

Template: 2Q6T, chain A
Confidence level:confident
Coverage over the Query: 49-236,250-359
View the alignment between query and template
View the model in PyMOL