Citrus Sinensis ID: 013573

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440

MVPADLNPQRSEQYVQTQGQCQTQSFASSPTIKGEMTVSSNELSLLGPIQMATTGTIVPAEVDSDEPKQMGQPTAGIQASHSDHKGGGPSMPSDDGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSHDGQITEIIYKGTHDHPKPQLSRRYSAGNMMSIQEERPDKVSSLTCRDGSMYGQMSHAMETNGTPDLSPVANDDSVEPDVDDDDQYSKRRKMDALVADVTPVVKPIREPRVVVQTLSEVDILDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNHDVPTARTSSHDAAGPSAGNGPCRIISEEGEAISLDLGVGISSATENRSNEQPQALHSELAHSHPHASSSSYKIIQANAVTAYSGVVNGGMNQYGSRGNPTEGRGVDFPPLNHSSYPYPQNIGRILTGP

cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHcccccccccccccccccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**********************************************************************************************DGYNWRKYGQKHVKGSEFPRSYYKCTHPNCEVKKLFERSHDGQITEIIYKGTHDHPKPQLSRRYSAGNMMSI**********LTCRDGSMYGQMSHAMETNGTPDLSPVANDDSVEPDVDDDD**********************REPRVVVQTLSEVDILDDGYRWRKYGQKVVRGNPNPRSYYKCTNAGCPVRKHVERASHDPKAVITTYEGKHNH*************************************************************************************************************************GRI****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable WRKY transcription factor 20	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element.	probable	Q93WV0

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WJ2, chain A
Confidence level:very confident
Coverage over the Query: 246-316
View the alignment between query and template
View the model in PyMOL

Template: 1WJ2, chain A
Confidence level:very confident
Coverage over the Query: 90-153
View the alignment between query and template
View the model in PyMOL