Citrus Sinensis ID: 013597

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MSSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSDVTTNKSSDLTYRSRFLLHDSADSIGLSGLLVLPQAFGAIYLGETFCSYISINNSSTLEVRDVVIKAEIQTDKQRILLLDTSKSPVESIRAGGRYDFIVEHDVKELGAHTLVCTALYSDGEGERKYLPQFFKFIVSNPLSVRTKVRVVKEITFLEACIENHTKSNLYMDQVEFEPSQNWSATMLKADGPHSDYNAQSREIFKPPVLIRSGGGIHNYLYQLKMLSHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVGIDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHLNLIATKLGVQRITGITVFDKLEKITYDSLPDLEIFVDQD

cccccccccEEEEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEcccccccEEEEEEEEEEccccEEEEcccccccccccccccCEEEEEEEEcEEEccEEEEEEEEEEcccccEEEEEEEEEEEEcccCEEEEEEEEEcccEEEEEEEEEcccccEEEEEEEEECcccccEEEcccccccccccccccccccccCEEEccccEEEEEEEEECcccccccccccccccccEEEEEEEEcccccccEEEEEEEEccccccccEEEEEEEcccEEEEcccEEEEEEEEEccccccccEEEEEEccccccccEEEEccccEEECcccccccCEEEEEEEEEccccEEEEccEEEEEccccEEEcccccEEEEEccc

*****GT**LAFRVMRLCRPSLHVEPPLRVDPTDLFIGE*************************************DSADSIGLSGLLVLPQAFGAIYLGETFCSYISINNSSTLEVRDVVIKAEIQTDKQRILLLDTSKSPVESIRAGGRYDFIVEHDVKELGAHTLVCTALYSDGEGERKYLPQFFKFIVSNPLSVRTKVRVVKEITFLEACIENHTKSNLYMDQVEFEPSQNWSATM***************EIFKPPVLIRSGGGIHNYLYQLKMLSH********QGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVGIDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHLNLIATKLGVQRITGITVFDKLEKITYDSLPDLEIFVDQD

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UPF0533 protein C5orf44 homolog		probable	Q3TIR1
UPF0533 protein CG4953		probable	Q95TN1
UPF0533 protein C5orf44 homolog		probable	A7MB76

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EX0, chain A
Confidence level:probable
Coverage over the Query: 154-240,251-413
View the alignment between query and template
View the model in PyMOL

Template: 2QSV, chain A
Confidence level:probable
Coverage over the Query: 93-229
View the alignment between query and template
View the model in PyMOL