Citrus Sinensis ID: 013602

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MSQLKQMSHLDNIPSTPGKFKMDKSPYFNRLRFHSSLAKLTFWSFIFLAVILIFFFRSPSSNPLPSADPSRRSLRTYDWGGPAFEKRVRSSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKKARQALLERSGIFIVEGDINDMALLKKLFDVVSFTHVMHLAAQAGVRYAMQNPNSYVHSNIAGLVSLLEVCKNANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGRAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYAGGKKAAG
ccccccccccccccccccccccccccccccEECHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEECcccccccccccHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEccccccccHHHHHHHHHHHHcccHHHHccccccccccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccc
************************SPYFNRLRFHSSLAKLTFWSFIFLAVILIFFFR***************************************RNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKKARQALLERSGIFIVEGDINDMALLKKLFDVVSFTHVMHLAAQAGVRYAMQNPNSYVHSNIAGLVSLLEVCKNANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTA***********GRAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYAG******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQLKQMSHLDNIPSTPGKFKMDKSPYFNRLRFHSSLAKLTFWSFIFLAVILIFFFRSPSSNPLPSADPSRRSLRTYDWGGPAFEKRVRSSARVRARNGISVLVTGAAGFVGTHVSAALKRRGDGVLGLDNFNDYYDPSLKKARQALLERSGIFIVEGDINDMALLKKLFDVVSFTHVMHLAAQAGVRYAMQNPNSYVHSNIAGLVSLLEVCKNANPQPAIVWASSSSVYGLNTKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILNRKSIPIFESPDHGTVARDFTYIDDIVKGCLAALDTAEKSTGSGGKKRGRAQLRVFNLGNTSPVPVSDLVSILERLLKVKAKRNIMKLPRNGDVPFTHANISLAQRELGYKPTTDLQTGLKKFVRWYLSYYAGGKKAAG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-glucuronate 4-epimerase 3 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.confidentO81312
UDP-glucuronate 4-epimerase 5 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.probableQ9STI6
UDP-glucuronate 4-epimerase 2 Involved in the synthesis of the negatively charged monosaccharide that forms the backbone of pectic cell wall components.probableQ9LPC1

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.1.-.-Racemases and epimerases.probable
5.1.3.-Acting on carbohydrates and derivatives.probable
5.1.3.6UDP-glucuronate 4-epimerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EGB, chain A
Confidence level:very confident
Coverage over the Query: 101-339,353-432
View the alignment between query and template
View the model in PyMOL