Citrus Sinensis ID: 013632

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MEIDGEEARLQRKQATYIFLDEPFEIQKETYRGQQYSQIYFARLHLMRALLYSLVPNWKPHLPICTVLELEEGRECVIIGTLYKHMKLKPSILDEYSKERSTTPLVKPHNFMHPDDHLVLEDESGRVKLGGAELLPSAYVTGIVVALHGKETSAGEFLVLDVLDAGLAPQKELPLNSGEDKYVVLVSGLNVGSGTSNPLQFQLLVDHITGHLGDEKEQGIAAEIVHVVIAGNSIEIPRGLLNGQNLASKDQSRLFEPIKELDILLTQIAAGVPLDIMPGPNDPANFSLPQQPLNRCLFPGSATYNTFRSCTNPHCFELDNVRFLGTSGQTIDDLQKYSEANDQLEFMERTLRWRHLAPTAPNTLGCYPFTDRDPFLVESCPHVYFAGNQQKFETRLLKGSDRQLVRLVCIPKFSETGVAVVVNLKNLECHTLSFGTQFS
cccccccccEEEcccEECccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEccccccEEEEEEEEEECccccccHHHHHHcccccccccccccccccccEEEEEccccEEEEEccccccccEEEcEEEEEEEEEcccccEEEEEEEcccccccccccccccccEEEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccccccccccccccccCECccccEEEEccEEEEEEccccHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccEEEcccccEEEEcccccccEEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEEEEEEcc
***********RKQATYIFLDEPFEIQKETYRGQQYSQIYFARLHLMRALLYSLVPNWKPHLPICTVLELEEGRECVIIGTLYKHMKLKPSILDEYSKERS*********FMHPDDHLVLEDESGRVKLGGAELLPSAYVTGIVVALHGKETSAGEFLVLDVLDAGLAPQKELPLNSGEDKYVVLVSGLNVGSGTSNPLQFQLLVDHITGHLGDEKEQGIAAEIVHVVIAGNSIEIPRGLLNGQNLASKDQSRLFEPIKELDILLTQIAAGVPLDIMPGPNDPANFSLPQQPLNRCLFPGSATYNTFRSCTNPHCFELDNVRFLGTSGQTIDDLQKYSEANDQLEFMERTLRWRHLAPTAPNTLGCYPFTDRDPFLVESCPHVYFAGNQQKFETRLLKGSDRQLVRLVCIPKFSETGVAVVVNLKNLECHTLSFGTQF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEIDGEEARLQRKQATYIFLDEPFEIQKETYRGQQYSQIYFARLHLMRALLYSLVPNWKPHLPICTVLELEEGRECVIIGTLYKHMKLKPSILDEYSKERSTTPLVKPHNFMHPDDHLVLEDESGRVKLGGAELLPSAYVTGIVVALHGKETSAGEFLVLDVLDAGLAPQKELPLNSGEDKYVVLVSGLNVGSGTSNPLQFQLLVDHITGHLGDEKEQGIAAEIVHVVIAGNSIEIPRGLLNGQNLASKDQSRLFEPIKELDILLTQIAAGVPLDIMPGPNDPANFSLPQQPLNRCLFPGSATYNTFRSCTNPHCFELDNVRFLGTSGQTIDDLQKYSEANDQLEFMERTLRWRHLAPTAPNTLGCYPFTDRDPFLVESCPHVYFAGNQQKFETRLLKGSDRQLVRLVCIPKFSETGVAVVVNLKNLECHTLSFGTQFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA polymerase delta small subunit The function of the small subunit is not yet clear.confidentQ9LRE5
DNA polymerase delta small subunit The function of the small subunit is not yet clear.confidentO48520
DNA polymerase delta small subunit DNA polymerase delta (DNA polymerase III) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.probableP46957

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.7.-Nucleotidyltransferases.probable
2.7.7.7DNA-directed DNA polymerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E0J, chain A
Confidence level:very confident
Coverage over the Query: 7-26,40-86,109-436
View the alignment between query and template
View the model in PyMOL