Citrus Sinensis ID: 013640


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MATYDLTQRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSLYHTEDVPQDMVERRVEVVARLKALEERAAPIVSFLQNPNSFQDLRANDQHYNLQMLHDRYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERRLSALWGKMAAEILMQNWDIALEELNQLKEKVDDPKSFTSPLNQMQSRIWLMHWSLFIFFNHDNGRTLIIDLFNQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLACVYVNYDFDGAQKKMKECEEVILNDPFLGKRVEDSNFATVPLRDEFLENARLFIFETYCRIHQRIDMAVLAEKLNLNYEEAQRWIVNLIRNSKLDAKIDAKSGTVIMEPTHPNVYEQLIDHTKGLSGRTYKLVGQLLEHAQTQAAR
ccccccHHHHcccccHHHHHHHHHHcHHcccccHHHHHHHHHHHHHcccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHEEcccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccccCEEEccccEEEEccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcc
*ATYDLTQRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSLYHTEDVPQDMVERRVEVVARLKALEERAAPIVSFLQNPNSFQDLRANDQHYNLQMLHDRYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERRLSALWGKMAAEILMQNWDIALEELNQLKEKVDDPKSFTSPLNQMQSRIWLMHWSLFIFFNHDNGRTLIIDLFNQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLACVYVNYDFDGAQKKMKECEEVILNDPFLGKRVEDSNFATVPLRDEFLENARLFIFETYCRIHQRIDMAVLAEKLNLNYEEAQRWIVNLIRNSKLDAKIDAKSGTVIMEPTHPNVYEQLIDHTKGLSGRTYKLVGQLL*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATYDLTQRIAPNLDRHLVFPLLEFLQERQMYPDEQILKSKIELLNKTNMVDYAMDIHKSLYHTEDVPQDMVERRVEVVARLKALEERAAPIVSFLQNPNSFQDLRANDQHYNLQMLHDRYQIGPDQIEALYQYAKFQFECGNYSGAADYLYQYRALCTNSERRLSALWGKMAxxxxxxxxxxxxxxxxxxxxxVDDPKSFTSPLNQMQSRIWLMHWSLFIFFNHDNGRTLIIDLFNQDKYLNAIQTNAPHLLRYLATAFIVNKRRRPQFKDFIKVIQQEQNSYKDPITEFLACVYVNYDFDGAQKKMKECEEVILNDPFLGKRVEDSNFATVPLRDEFLENARLFIFETYCRIHQRIDMAVLAEKLNLNYEEAQRWIVNLIRNSKLDAKIDAKSGTVIMEPTHPNVYEQLIDHTKGLSGRTYKLVGQLLEHAQTQAAR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 3 subunit E Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.probableQ5ZLA5
Eukaryotic translation initiation factor 3 subunit E-A Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.probableQ6DRI1
Eukaryotic translation initiation factor 3 subunit E Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S preinitiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of posttermination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation. Required for nonsense-mediated mRNA decay (NMD); may act in conjunction with UPF2 to divert mRNAs from translation to the NMD pathway. May interact with MCM7 and EPAS1 and regulate the proteasome-mediated degradation of these proteins.probableP60228

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain R
Confidence level:confident
Coverage over the Query: 35-321,333-402
View the alignment between query and template
View the model in PyMOL