Citrus Sinensis ID: 013663


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MATSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
ccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHcHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccc
*****AWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEED**LPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transportin-1 Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.probableB9FDR3
Transportin-1 Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the glycine-rich RNA-binding RBG7 and mediates its nuclear import.probableQ8H0U4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FDD, chain A
Confidence level:very confident
Coverage over the Query: 7-326,363-436
View the alignment between query and template
View the model in PyMOL
Template: 2QMR, chain A
Confidence level:very confident
Coverage over the Query: 8-325,362-435
View the alignment between query and template
View the model in PyMOL