Citrus Sinensis ID: 013663

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MATSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
ccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccHHHcHHHHHHHHHHHHcHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHccccc
ccccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHccccccHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccHHHccHHHccHHHccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEc
matsvawqpqeqGFNEICRLLEqqispsstadkSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTayksmspsnqqyiksellpclgaadrhirsTVGTIVSVVVQLGGIAGWLELLQALVTCldsndinhMEGAMDALSKICedipqvldsdvpglaecpiniflprllqffqsphtslrklslgSVNQFIMLMPSALFVSMDQYLQGLfllsndpsaEVRKLVCAAFNLLIevrpsflephLRNLFEYMLQVnkdtdddvALEACEFWHSYFEAqlphenlkeflPRLVPVLLSnmiyadddeslveaeedeslpdrdqdlkprfhssrlhgsenpedddddivnVWNLRKCSAAALDVLSnvfgdeilptlMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIkglyphlsevifve
matsvawqpqeQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEedeslpdrdqdlkprfhssrlhgsenpeddddDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
MATSVAWQPQEQGFNEICRLLEQQISPSSTADKSqiwqqlqqysqFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
*************FNEICRLL*************QIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYK*******QYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYA******************************************DIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFV*
****VAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
*********QEQGFNEICRLLEQQI***********WQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDES************RDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
*****AWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEED**LPDRDQDLKPRFHSSRL**************NVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIFVE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query438 2.2.26 [Sep-21-2011]
Q8H0U4 891 Transportin-1 OS=Arabidop yes no 0.990 0.487 0.785 0.0
B8ARW2 890 Transportin-1 OS=Oryza sa N/A no 0.988 0.486 0.704 0.0
B9FDR3 891 Transportin-1 OS=Oryza sa yes no 0.986 0.484 0.705 0.0
Q8BFY9 898 Transportin-1 OS=Mus musc yes no 0.963 0.469 0.428 7e-93
Q92973 898 Transportin-1 OS=Homo sap yes no 0.963 0.469 0.426 4e-92
Q3SYU7 898 Transportin-1 OS=Bos taur yes no 0.963 0.469 0.426 4e-92
Q99LG2 887 Transportin-2 OS=Mus musc no no 0.963 0.475 0.429 8e-86
O14787 897 Transportin-2 OS=Homo sap no no 0.963 0.470 0.429 8e-86
O14089 910 Importin subunit beta-2 O yes no 0.963 0.463 0.354 4e-67
Q55CQ7 931 Transportin OS=Dictyostel yes no 0.753 0.354 0.385 7e-65
>sp|Q8H0U4|TNPO1_ARATH Transportin-1 OS=Arabidopsis thaliana GN=TRN1 PE=1 SV=1 Back     alignment and function desciption
 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/434 (78%), Positives = 389/434 (89%)

Query: 2   ATSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAE 61
           AT+V WQP++ G  EIC LLEQQISPSS  DKSQIW+QLQ +SQFPDFNNYL FIL RAE
Sbjct: 3   ATAVVWQPRDDGLAEICSLLEQQISPSSVVDKSQIWKQLQHFSQFPDFNNYLVFILVRAE 62

Query: 62  GKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVV 121
           GKSVE+RQAAGLLLKNNLR AY SM+  NQ+YIKSELLPCLGAADR+IR+TVGTI+SV+V
Sbjct: 63  GKSVEVRQAAGLLLKNNLRGAYPSMTQENQKYIKSELLPCLGAADRNIRTTVGTIISVIV 122

Query: 122 QLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIF 181
            + G++GW ELL ALVTCLDSND+NHM+GAMDALSKICEDIP VLD++VPGLAE PINIF
Sbjct: 123 NIEGVSGWHELLPALVTCLDSNDLNHMDGAMDALSKICEDIPHVLDTEVPGLAERPINIF 182

Query: 182 LPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLV 241
           LPRLLQFFQSPH SLRKL+LGSVNQ+I++MP+AL+ S+D+YLQGLF+L+NDP  EVRKLV
Sbjct: 183 LPRLLQFFQSPHASLRKLALGSVNQYIIIMPAALYNSLDKYLQGLFVLANDPVPEVRKLV 242

Query: 242 CAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKE 301
           CAAF  L EV PS +EPHLRN+ EYMLQVN+D D++V+LEACEFW +Y +AQLP ENLKE
Sbjct: 243 CAAFVHLTEVLPSSIEPHLRNVMEYMLQVNRDPDEEVSLEACEFWSAYCDAQLPPENLKE 302

Query: 302 FLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDI 361
           FLPRL+PVLL NM YADDDESL++AEEDES PDRDQDLKPRFH+SRLHGSE+ +DDDDD 
Sbjct: 303 FLPRLIPVLLENMAYADDDESLLDAEEDESQPDRDQDLKPRFHTSRLHGSEDFDDDDDDS 362

Query: 362 VNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAE 421
            NVWNLRKCSAAA+DVLSNVFGDEILP LMP+IQ  LSASGDEAWK REAAVLALGAIAE
Sbjct: 363 FNVWNLRKCSAAAIDVLSNVFGDEILPALMPLIQKNLSASGDEAWKQREAAVLALGAIAE 422

Query: 422 GCIKGLYPHLSEVI 435
           GC+ GLYPHLSE++
Sbjct: 423 GCMNGLYPHLSEIV 436
Functions in nuclear protein import as nuclear transport receptor. Serves as receptor for nuclear localization signals (NLS) in cargo substrates. Is thought to mediate docking of the importin/substrate complex to the nuclear pore complex (NPC) through binding to nucleoporin and the complex is subsequently translocated through the pore by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to the importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus (By similarity). Involved in nuclear import of M9-containing proteins. In vitro, binds directly to the M9 region of the glycine-rich RNA-binding RBG7 and mediates its nuclear import.
Arabidopsis thaliana (taxid: 3702)
>sp|B8ARW2|TNPO1_ORYSI Transportin-1 OS=Oryza sativa subsp. indica GN=OsI_18044 PE=2 SV=1 Back     alignment and function description
>sp|B9FDR3|TNPO1_ORYSJ Transportin-1 OS=Oryza sativa subsp. japonica GN=TRN1 PE=3 SV=2 Back     alignment and function description
>sp|Q8BFY9|TNPO1_MOUSE Transportin-1 OS=Mus musculus GN=Tnpo1 PE=1 SV=2 Back     alignment and function description
>sp|Q92973|TNPO1_HUMAN Transportin-1 OS=Homo sapiens GN=TNPO1 PE=1 SV=2 Back     alignment and function description
>sp|Q3SYU7|TNPO1_BOVIN Transportin-1 OS=Bos taurus GN=TNPO1 PE=2 SV=2 Back     alignment and function description
>sp|Q99LG2|TNPO2_MOUSE Transportin-2 OS=Mus musculus GN=Tnpo2 PE=2 SV=1 Back     alignment and function description
>sp|O14787|TNPO2_HUMAN Transportin-2 OS=Homo sapiens GN=TNPO2 PE=1 SV=3 Back     alignment and function description
>sp|O14089|IMB2_SCHPO Importin subunit beta-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kap104 PE=3 SV=1 Back     alignment and function description
>sp|Q55CQ7|TNPO_DICDI Transportin OS=Dictyostelium discoideum GN=tnpo PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
449458638 891 PREDICTED: transportin-1-like [Cucumis s 0.993 0.488 0.832 0.0
449518111 627 PREDICTED: transportin-1-like [Cucumis s 0.993 0.693 0.832 0.0
356536398 893 PREDICTED: transportin-1-like isoform 1 0.990 0.486 0.820 0.0
224078397 888 predicted protein [Populus trichocarpa] 0.988 0.487 0.838 0.0
224105121 886 predicted protein [Populus trichocarpa] 0.993 0.490 0.829 0.0
356536400 897 PREDICTED: transportin-1-like isoform 2 0.990 0.483 0.812 0.0
255560489 824 importin beta-2, putative [Ricinus commu 0.988 0.525 0.826 0.0
359475006 896 PREDICTED: transportin-1-like [Vitis vin 0.988 0.483 0.806 0.0
356575454 896 PREDICTED: transportin-1-like [Glycine m 0.990 0.484 0.817 0.0
79322370 891 transportin 1 [Arabidopsis thaliana] gi| 0.990 0.487 0.785 0.0
>gi|449458638|ref|XP_004147054.1| PREDICTED: transportin-1-like [Cucumis sativus] Back     alignment and taxonomy information
 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/435 (83%), Positives = 401/435 (92%)

Query: 1   MATSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARA 60
           MA S +W PQE GFNEIC LLEQQISP+S  DKSQIWQQLQQYSQFPDFNNYLAFILARA
Sbjct: 1   MAASASWHPQENGFNEICGLLEQQISPTSNPDKSQIWQQLQQYSQFPDFNNYLAFILARA 60

Query: 61  EGKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVV 120
           EGKSVE+RQAAGLLLKNNLRTAYKSM+P  QQYIKSELLPC+GAADRHIRSTVGTI+SV+
Sbjct: 61  EGKSVEVRQAAGLLLKNNLRTAYKSMTPVFQQYIKSELLPCMGAADRHIRSTVGTIISVI 120

Query: 121 VQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINI 180
           VQLGGI GW ELLQALV CLDS D NHMEGAMDALSKICEDIPQVLDSDVPGL+E PIN+
Sbjct: 121 VQLGGILGWPELLQALVRCLDSKDQNHMEGAMDALSKICEDIPQVLDSDVPGLSERPINV 180

Query: 181 FLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKL 240
           FLPRL QFFQSPH +LRKLSL SVNQ+IMLMP+AL++SMDQYLQGLF+L+ND ++EVRKL
Sbjct: 181 FLPRLFQFFQSPHATLRKLSLSSVNQYIMLMPTALYISMDQYLQGLFVLANDSTSEVRKL 240

Query: 241 VCAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLK 300
           VC AF  LIEVRP+FLEPHLRN+ EYMLQVNKD D++V+LEACEFW +Y +AQLP ENL+
Sbjct: 241 VCQAFVQLIEVRPTFLEPHLRNVIEYMLQVNKDADEEVSLEACEFWSAYCDAQLPPENLR 300

Query: 301 EFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDD 360
           EFLPRL+P LLSNM+YADDDESL+EAEED SLPDR+QDLKPRFHSSRLHGSEN EDDDDD
Sbjct: 301 EFLPRLIPALLSNMVYADDDESLLEAEEDGSLPDREQDLKPRFHSSRLHGSENAEDDDDD 360

Query: 361 IVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIA 420
           IVN+WNLRKCSAAALD+LSNVFGD+ILP LMPV++A LSA+GDEAWK+REAAVLALGAIA
Sbjct: 361 IVNIWNLRKCSAAALDILSNVFGDDILPMLMPVVEANLSANGDEAWKEREAAVLALGAIA 420

Query: 421 EGCIKGLYPHLSEVI 435
           EGCI GLYPHL E++
Sbjct: 421 EGCITGLYPHLPEIV 435

Source: Cucumis sativus

Species: Cucumis sativus

Genus: Cucumis

Family: Cucurbitaceae

Order: Cucurbitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|449518111|ref|XP_004166087.1| PREDICTED: transportin-1-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356536398|ref|XP_003536725.1| PREDICTED: transportin-1-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|224078397|ref|XP_002305534.1| predicted protein [Populus trichocarpa] gi|222848498|gb|EEE86045.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105121|ref|XP_002313694.1| predicted protein [Populus trichocarpa] gi|222850102|gb|EEE87649.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356536400|ref|XP_003536726.1| PREDICTED: transportin-1-like isoform 2 [Glycine max] Back     alignment and taxonomy information
>gi|255560489|ref|XP_002521259.1| importin beta-2, putative [Ricinus communis] gi|223539527|gb|EEF41115.1| importin beta-2, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359475006|ref|XP_002280484.2| PREDICTED: transportin-1-like [Vitis vinifera] gi|297744566|emb|CBI37828.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356575454|ref|XP_003555856.1| PREDICTED: transportin-1-like [Glycine max] Back     alignment and taxonomy information
>gi|79322370|ref|NP_001031359.1| transportin 1 [Arabidopsis thaliana] gi|25083223|gb|AAN72052.1| putative transportin [Arabidopsis thaliana] gi|31711774|gb|AAP68243.1| At2g16950 [Arabidopsis thaliana] gi|330251468|gb|AEC06562.1| transportin 1 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
TAIR|locus:2039410 891 TRN1 "AT2G16950" [Arabidopsis 0.990 0.487 0.767 3.8e-181
MGI|MGI:2681523 898 Tnpo1 "transportin 1" [Mus mus 0.963 0.469 0.426 5e-92
UNIPROTKB|F1LQP9 897 Tnpo1 "Protein Tnpo1" [Rattus 0.963 0.470 0.426 5e-92
UNIPROTKB|Q3SYU7 898 TNPO1 "Transportin-1" [Bos tau 0.963 0.469 0.426 1e-91
UNIPROTKB|Q92973 898 TNPO1 "Transportin-1" [Homo sa 0.963 0.469 0.424 1.7e-91
UNIPROTKB|I3LM93 893 TNPO1 "Uncharacterized protein 0.963 0.472 0.424 2.1e-91
UNIPROTKB|F1PRW7 1048 TNPO2 "Uncharacterized protein 0.963 0.402 0.432 9.3e-91
UNIPROTKB|O14787 897 TNPO2 "Transportin-2" [Homo sa 0.963 0.470 0.432 9.3e-91
UNIPROTKB|F1SEX5 887 TNPO2 "Uncharacterized protein 0.963 0.475 0.432 9.3e-91
MGI|MGI:2384849 887 Tnpo2 "transportin 2 (importin 0.963 0.475 0.432 9.3e-91
TAIR|locus:2039410 TRN1 "AT2G16950" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1758 (623.9 bits), Expect = 3.8e-181, P = 3.8e-181
 Identities = 333/434 (76%), Positives = 379/434 (87%)

Query:     2 ATSVAWQPQEQGFNEICRLLEQQISPSSTADKSXXXXXXXXXXXFPDFNNYLAFILARAE 61
             AT+V WQP++ G  EIC LLEQQISPSS  DKS           FPDFNNYL FIL RAE
Sbjct:     3 ATAVVWQPRDDGLAEICSLLEQQISPSSVVDKSQIWKQLQHFSQFPDFNNYLVFILVRAE 62

Query:    62 GKSVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVV 121
             GKSVE+RQAAGLLLKNNLR AY SM+  NQ+YIKSELLPCLGAADR+IR+TVGTI+SV+V
Sbjct:    63 GKSVEVRQAAGLLLKNNLRGAYPSMTQENQKYIKSELLPCLGAADRNIRTTVGTIISVIV 122

Query:   122 QLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIF 181
              + G++GW ELL ALVTCLDSND+NHM+GAMDALSKICEDIP VLD++VPGLAE PINIF
Sbjct:   123 NIEGVSGWHELLPALVTCLDSNDLNHMDGAMDALSKICEDIPHVLDTEVPGLAERPINIF 182

Query:   182 LPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLV 241
             LPRLLQFFQSPH SLRKL+LGSVNQ+I++MP+AL+ S+D+YLQGLF+L+NDP  EVRKLV
Sbjct:   183 LPRLLQFFQSPHASLRKLALGSVNQYIIIMPAALYNSLDKYLQGLFVLANDPVPEVRKLV 242

Query:   242 CAAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKE 301
             CAAF  L EV PS +EPHLRN+ EYMLQVN+D D++V+LEACEFW +Y +AQLP ENLKE
Sbjct:   243 CAAFVHLTEVLPSSIEPHLRNVMEYMLQVNRDPDEEVSLEACEFWSAYCDAQLPPENLKE 302

Query:   302 FLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDI 361
             FLPRL+PVLL NM YADDDESL++AEEDES PDRDQDLKPRFH+SRLHGSE+ +DDDDD 
Sbjct:   303 FLPRLIPVLLENMAYADDDESLLDAEEDESQPDRDQDLKPRFHTSRLHGSEDFDDDDDDS 362

Query:   362 VNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAE 421
              NVWNLRKCSAAA+DVLSNVFGDEILP LMP+IQ  LSASGDEAWK REAAVLALGAIAE
Sbjct:   363 FNVWNLRKCSAAAIDVLSNVFGDEILPALMPLIQKNLSASGDEAWKQREAAVLALGAIAE 422

Query:   422 GCIKGLYPHLSEVI 435
             GC+ GLYPHLSE++
Sbjct:   423 GCMNGLYPHLSEIV 436
GO:0000059 "protein import into nucleus, docking" evidence=ISS
GO:0005634 "nucleus" evidence=ISS;IDA
GO:0005643 "nuclear pore" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS;IDA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0008565 "protein transporter activity" evidence=IEA;ISS;IDA
GO:0051170 "nuclear import" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0006486 "protein glycosylation" evidence=RCA
GO:0006487 "protein N-linked glycosylation" evidence=RCA
GO:0052541 "plant-type cell wall cellulose metabolic process" evidence=RCA
GO:0052546 "cell wall pectin metabolic process" evidence=RCA
MGI|MGI:2681523 Tnpo1 "transportin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQP9 Tnpo1 "Protein Tnpo1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SYU7 TNPO1 "Transportin-1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q92973 TNPO1 "Transportin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM93 TNPO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PRW7 TNPO2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O14787 TNPO2 "Transportin-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SEX5 TNPO2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:2384849 Tnpo2 "transportin 2 (importin 3, karyopherin beta 2b)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8H0U4TNPO1_ARATHNo assigned EC number0.78570.99080.4870yesno
B9FDR3TNPO1_ORYSJNo assigned EC number0.70570.98630.4848yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
COG5215 858 COG5215, KAP95, Karyopherin (importin) beta [Intra 1e-17
pfam0381071 pfam03810, IBN_N, Importin-beta N-terminal domain 7e-10
smart0091367 smart00913, IBN_N, Importin-beta N-terminal domain 9e-09
>gnl|CDD|227540 COG5215, KAP95, Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information 
 Score = 85.4 bits (211), Expect = 1e-17
 Identities = 83/433 (19%), Positives = 169/433 (39%), Gaps = 67/433 (15%)

Query: 16  EICRLLEQQI-SPSSTADKSQIWQQLQ-QYSQFPDFNNYLAFILARAEGKSVEIRQAAGL 73
           E   L +  + SP   A      Q L+ Q   F  F + L  +L      + ++R  AGL
Sbjct: 5   EFRCLGKNHVLSPDPNARLRAEAQLLELQSGDFEQFISLLVQVLCD-LNSNDQLRMVAGL 63

Query: 74  LLKNNL-----------RTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQ 122
           +LKN+L              +  M   +++ +K   L  L + +    +    +++ + +
Sbjct: 64  ILKNSLHANDPELQKGCSQRWLGMRHESKEQVKGMALRALKSPEPRFCTMAAQLLAAIAR 123

Query: 123 LGGIAG-WLELLQALV--TCLDSNDINHMEGAMDALSKICEDI-PQVLDSDVPGLAECPI 178
           +      W  L++ +V     D   ++    ++      CE   P+ L            
Sbjct: 124 MELPNSLWPGLMEEMVRNVG-DEQPVSGKCESLGICGYHCESEAPEDLIQMS-------- 174

Query: 179 NIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFV--------SMDQYLQGLFLLS 230
           N+ L  ++       T+   + L ++     LM S +FV          + ++Q +   +
Sbjct: 175 NVILFAIVMGALKNETTSA-VRLAALK---ALMDSLMFVQGNFCYEEERNYFMQVVCEAT 230

Query: 231 NDPSAEVRKLVCAAFNLLIEVRPSFLEPHLRN-LFEYMLQVNKDTDDDVALEACEFWHSY 289
                E++       N ++ +   F++ ++ N L     +  K  +D+VA++A EFW + 
Sbjct: 231 QGNDEELQHAAFGCLNKIMMLYYKFMQSYMENALAALTGRFMKSQNDEVAIQAVEFWSTI 290

Query: 290 FEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLH 349
            E ++  E   ++LP                   V A+          D+ P   S    
Sbjct: 291 CEEEIDGEMEDKYLPE------------------VPAQNHGFARAAVADVLPELLSLLEK 332

Query: 350 GSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDR 409
             E+   DD      WN    +++ L + + + GD+I+  ++  ++  + +   E+W +R
Sbjct: 333 QGEDYYGDD------WNPSMAASSCLQLFAQLKGDKIMRPVLGFVEQNIRS---ESWANR 383

Query: 410 EAAVLALGAIAEG 422
           EAAV+A G++  G
Sbjct: 384 EAAVMAFGSVMHG 396

Length = 858
>gnl|CDD|217743 pfam03810, IBN_N, Importin-beta N-terminal domain Back     alignment and domain information
>gnl|CDD|197981 smart00913, IBN_N, Importin-beta N-terminal domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 438
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 100.0
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 100.0
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 100.0
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 100.0
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 100.0
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 99.97
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 99.91
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 99.89
COG5656 970 SXM1 Importin, protein involved in nuclear import 99.88
COG5657 947 CSE1 CAS/CSE protein involved in chromosome segreg 99.86
KOG2021 980 consensus Nuclear mRNA export factor receptor LOS1 99.8
KOG2171 1075 consensus Karyopherin (importin) beta 3 [Nuclear s 99.8
KOG2023 885 consensus Nuclear transport receptor Karyopherin-b 99.76
KOG1824 1233 consensus TATA-binding protein-interacting protein 99.72
KOG2081 559 consensus Nuclear transport regulator [Intracellul 99.72
KOG2022 982 consensus Nuclear transport receptor LGL2 (importi 99.66
KOG18241233 consensus TATA-binding protein-interacting protein 99.6
KOG1241 859 consensus Karyopherin (importin) beta 1 [Nuclear s 99.57
KOG1242 569 consensus Protein containing adaptin N-terminal re 99.57
COG5101 1053 CRM1 Importin beta-related nuclear transport recep 99.57
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 99.47
KOG1242569 consensus Protein containing adaptin N-terminal re 99.46
KOG0212 675 consensus Uncharacterized conserved protein [Funct 99.36
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.32
PRK09687280 putative lyase; Provisional 99.32
PTZ00429 746 beta-adaptin; Provisional 99.31
PRK09687280 putative lyase; Provisional 99.3
KOG2020 1041 consensus Nuclear transport receptor CRM1/MSN5 (im 99.3
PF01602 526 Adaptin_N: Adaptin N terminal region; InterPro: IP 99.29
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.27
KOG0166 514 consensus Karyopherin (importin) alpha [Intracellu 99.26
KOG0166514 consensus Karyopherin (importin) alpha [Intracellu 99.21
PF0381077 IBN_N: Importin-beta N-terminal domain; InterPro: 99.2
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 99.17
PTZ00429 746 beta-adaptin; Provisional 99.12
PF10508 503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.12
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 99.12
PF10508503 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; 99.11
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 99.1
COG5215 858 KAP95 Karyopherin (importin) beta [Intracellular t 99.09
KOG0212 675 consensus Uncharacterized conserved protein [Funct 99.08
PLN03200 2102 cellulose synthase-interactive protein; Provisiona 98.99
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.98
KOG0213 1172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.98
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 98.95
KOG02131172 consensus Splicing factor 3b, subunit 1 [RNA proce 98.89
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.89
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.89
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 98.86
KOG1991 1010 consensus Nuclear transport receptor RANBP7/RANBP8 98.86
PF12348228 CLASP_N: CLASP N terminal; InterPro: IPR024395 Thi 98.82
KOG0915 1702 consensus Uncharacterized conserved protein [Funct 98.79
KOG1410 1082 consensus Nuclear transport receptor RanBP16 (impo 98.73
COG5181975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.73
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.67
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.67
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 98.59
PF1275597 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region 98.54
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 98.54
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.53
PF12460415 MMS19_C: RNAPII transcription regulator C-terminal 98.52
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 98.43
COG5181 975 HSH155 U2 snRNP spliceosome subunit [RNA processin 98.43
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 98.43
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.37
KOG0211 759 consensus Protein phosphatase 2A regulatory subuni 98.36
KOG1240 1431 consensus Protein kinase containing WD40 repeats [ 98.36
PF12717178 Cnd1: non-SMC mitotic condensation complex subunit 98.35
KOG2956516 consensus CLIP-associating protein [General functi 98.31
KOG1248 1176 consensus Uncharacterized conserved protein [Funct 98.27
KOG4224550 consensus Armadillo repeat protein VAC8 required f 98.27
KOG2956516 consensus CLIP-associating protein [General functi 98.22
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 98.18
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 98.18
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.17
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 98.14
cd00020120 ARM Armadillo/beta-catenin-like repeats. An approx 98.14
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 98.13
KOG1059 877 consensus Vesicle coat complex AP-3, delta subunit 98.11
COG5064526 SRP1 Karyopherin (importin) alpha [Intracellular t 98.09
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 98.09
KOG4653982 consensus Uncharacterized conserved protein [Funct 98.05
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 98.04
KOG2259 823 consensus Uncharacterized conserved protein [Funct 98.02
KOG19671030 consensus DNA repair/transcription protein Mms19 [ 97.98
PF14500262 MMS19_N: Dos2-interacting transcription regulator 97.96
KOG1062 866 consensus Vesicle coat complex AP-1, gamma subunit 97.93
KOG4224550 consensus Armadillo repeat protein VAC8 required f 97.9
KOG1943 1133 consensus Beta-tubulin folding cofactor D [Posttra 97.86
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.83
KOG2259 823 consensus Uncharacterized conserved protein [Funct 97.8
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 97.75
KOG4653982 consensus Uncharacterized conserved protein [Funct 97.73
KOG2274 1005 consensus Predicted importin 9 [Intracellular traf 97.69
PF04826254 Arm_2: Armadillo-like; InterPro: IPR006911 This en 97.68
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 97.68
KOG4413 524 consensus 26S proteasome regulatory complex, subun 97.68
KOG1077 938 consensus Vesicle coat complex AP-2, alpha subunit 97.68
KOG1060 968 consensus Vesicle coat complex AP-3, beta subunit 97.67
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.65
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.63
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 97.63
PF05004309 IFRD: Interferon-related developmental regulator ( 97.62
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.6
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 97.59
PF05918 556 API5: Apoptosis inhibitory protein 5 (API5); Inter 97.59
KOG1820 815 consensus Microtubule-associated protein [Cytoskel 97.56
PF08167165 RIX1: rRNA processing/ribosome biogenesis 97.56
COG5240 898 SEC21 Vesicle coat complex COPI, gamma subunit [In 97.55
KOG1020 1692 consensus Sister chromatid cohesion protein SCC2/N 97.53
TIGR02270410 conserved hypothetical protein. Members are found 97.52
PF1364688 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2I 97.46
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 97.42
KOG1993 978 consensus Nuclear transport receptor KAP120 (impor 97.41
TIGR02270410 conserved hypothetical protein. Members are found 97.39
KOG2032533 consensus Uncharacterized conserved protein [Funct 97.39
PF05004309 IFRD: Interferon-related developmental regulator ( 97.38
PF1351355 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O 97.37
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.36
KOG2025 892 consensus Chromosome condensation complex Condensi 97.36
COG1413335 FOG: HEAT repeat [Energy production and conversion 97.33
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 97.3
PF0298531 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT re 97.29
COG5096 757 Vesicle coat complex, various subunits [Intracellu 97.26
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 97.25
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 97.25
KOG1058 948 consensus Vesicle coat complex COPI, beta subunit 97.19
KOG2025 892 consensus Chromosome condensation complex Condensi 97.18
KOG04141251 consensus Chromosome condensation complex Condensi 97.16
PF04510174 DUF577: Family of unknown function (DUF577); Inter 97.16
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 97.11
KOG1061 734 consensus Vesicle coat complex AP-1/AP-2/AP-4, bet 97.09
PF13251182 DUF4042: Domain of unknown function (DUF4042) 97.08
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 97.02
PF12719298 Cnd3: Nuclear condensing complex subunits, C-term 96.99
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 96.98
PF08167165 RIX1: rRNA processing/ribosome biogenesis 96.97
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 96.94
KOG2022 982 consensus Nuclear transport receptor LGL2 (importi 96.93
KOG2062929 consensus 26S proteasome regulatory complex, subun 96.91
PF14500262 MMS19_N: Dos2-interacting transcription regulator 96.88
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 96.88
PF13251182 DUF4042: Domain of unknown function (DUF4042) 96.84
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 96.83
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.82
KOG1992 960 consensus Nuclear export receptor CSE1/CAS (import 96.82
PLN03076 1780 ARF guanine nucleotide exchange factor (ARF-GEF); 96.71
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 96.67
PF05804 708 KAP: Kinesin-associated protein (KAP) 96.67
KOG1078 865 consensus Vesicle coat complex COPI, gamma subunit 96.63
PF08569335 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like pro 96.59
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 96.59
KOG1517 1387 consensus Guanine nucleotide binding protein MIP1 96.55
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 96.54
KOG2032533 consensus Uncharacterized conserved protein [Funct 96.52
KOG2137700 consensus Protein kinase [Signal transduction mech 96.49
KOG2549 576 consensus Transcription initiation factor TFIID, s 96.41
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 96.41
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 96.41
PF1036392 DUF2435: Protein of unknown function (DUF2435) 96.4
KOG04141251 consensus Chromosome condensation complex Condensi 96.39
PF1036392 DUF2435: Protein of unknown function (DUF2435) 96.38
PF10274183 ParcG: Parkin co-regulated protein; InterPro: IPR0 96.37
PF03378 435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 96.35
PF05804708 KAP: Kinesin-associated protein (KAP) 96.27
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 96.24
KOG0168 1051 consensus Putative ubiquitin fusion degradation pr 96.21
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 96.2
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 96.19
KOG1949 1005 consensus Uncharacterized conserved protein [Funct 96.05
KOG4535728 consensus HEAT and armadillo repeat-containing pro 96.0
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 95.95
COG5098 1128 Chromosome condensation complex Condensin, subunit 95.92
KOG1243690 consensus Protein kinase [General function predict 95.9
KOG2933334 consensus Uncharacterized conserved protein [Funct 95.86
KOG1243690 consensus Protein kinase [General function predict 95.81
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 95.75
COG5218 885 YCG1 Chromosome condensation complex Condensin, su 95.7
KOG2149393 consensus Uncharacterized conserved protein [Funct 95.68
KOG4413524 consensus 26S proteasome regulatory complex, subun 95.61
COG5656 970 SXM1 Importin, protein involved in nuclear import 95.6
PF08064107 UME: UME (NUC010) domain; InterPro: IPR012993 This 95.59
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 95.55
KOG2149393 consensus Uncharacterized conserved protein [Funct 95.53
PF13001501 Ecm29: Proteasome stabiliser; InterPro: IPR024372 95.49
PF05536 543 Neurochondrin: Neurochondrin 95.45
PF08623169 TIP120: TATA-binding protein interacting (TIP20); 95.45
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 95.4
KOG0392 1549 consensus SNF2 family DNA-dependent ATPase domain- 95.38
PF14664371 RICTOR_N: Rapamycin-insensitive companion of mTOR, 95.35
KOG2062929 consensus 26S proteasome regulatory complex, subun 95.35
KOG2933334 consensus Uncharacterized conserved protein [Funct 95.33
KOG2021 980 consensus Nuclear mRNA export factor receptor LOS1 95.29
PF0757192 DUF1546: Protein of unknown function (DUF1546); In 95.29
PF08506370 Cse1: Cse1; InterPro: IPR013713 The exchange of ma 95.23
PF10521282 DUF2454: Protein of unknown function (DUF2454); In 95.15
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 95.12
KOG1293678 consensus Proteins containing armadillo/beta-caten 95.12
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 94.82
smart00802107 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1. 94.82
COG5116926 RPN2 26S proteasome regulatory complex component [ 94.75
KOG2160342 consensus Armadillo/beta-catenin-like repeat-conta 94.73
PF03378435 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: I 94.65
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 94.63
KOG1293678 consensus Proteins containing armadillo/beta-caten 94.47
smart00638574 LPD_N Lipoprotein N-terminal Domain. 94.38
COG5116926 RPN2 26S proteasome regulatory complex component [ 94.04
PF11865160 DUF3385: Domain of unknown function (DUF3385); Int 94.04
PF05536 543 Neurochondrin: Neurochondrin 94.0
KOG1525 1266 consensus Sister chromatid cohesion complex Cohesi 93.96
PF08767319 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 93.9
PF01603409 B56: Protein phosphatase 2A regulatory B subunit ( 93.88
KOG2081559 consensus Nuclear transport regulator [Intracellul 93.79
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 93.46
cd08050343 TAF6 TATA Binding Protein (TBP) Associated Factor 93.41
COG5098 1128 Chromosome condensation complex Condensin, subunit 93.26
KOG2549576 consensus Transcription initiation factor TFIID, s 93.25
PF01347618 Vitellogenin_N: Lipoprotein amino terminal region; 93.25
KOG0567289 consensus HEAT repeat-containing protein [General 93.25
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 93.2
PF03224312 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004 93.16
KOG1822 2067 consensus Uncharacterized conserved protein [Funct 93.1
PF08767319 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 93.03
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 92.85
KOG0946 970 consensus ER-Golgi vesicle-tethering protein p115 92.43
PF04118307 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 Do 92.32
KOG0567289 consensus HEAT repeat-containing protein [General 92.08
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 92.04
KOG2137700 consensus Protein kinase [Signal transduction mech 92.03
cd00256429 VATPase_H VATPase_H, regulatory vacuolar ATP synth 91.89
smart00638574 LPD_N Lipoprotein N-terminal Domain. 91.67
COG5095450 TAF6 Transcription initiation factor TFIID, subuni 91.33
PF12054441 DUF3535: Domain of unknown function (DUF3535); Int 91.13
KOG4500604 consensus Rho/Rac GTPase guanine nucleotide exchan 90.56
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 90.55
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 90.06
PF11707330 Npa1: Ribosome 60S biogenesis N-terminal; InterPro 90.05
PF0932486 DUF1981: Domain of unknown function (DUF1981); Int 89.93
KOG0413 1529 consensus Uncharacterized conserved protein relate 89.72
PF1276542 Cohesin_HEAT: HEAT repeat associated with sister c 89.66
PF12783168 Sec7_N: Guanine nucleotide exchange factor in Golg 89.51
cd03568144 VHS_STAM VHS domain family, STAM subfamily; member 89.32
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 89.18
KOG18511710 consensus Uncharacterized conserved protein [Funct 88.76
cd03561133 VHS VHS domain family; The VHS domain is present i 88.74
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 88.67
KOG18371621 consensus Uncharacterized conserved protein [Funct 88.49
KOG0413 1529 consensus Uncharacterized conserved protein relate 88.46
KOG3961262 consensus Uncharacterized conserved protein [Funct 88.4
PF12830187 Nipped-B_C: Sister chromatid cohesion C-terminus 88.17
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 88.1
PF08713213 DNA_alkylation: DNA alkylation repair enzyme; Inte 87.89
KOG09291514 consensus Guanine nucleotide exchange factor [Intr 87.74
PF04078262 Rcd1: Cell differentiation family, Rcd1-like ; Int 87.66
KOG0803 1312 consensus Predicted E3 ubiquitin ligase [Posttrans 87.63
cd03572122 ENTH_epsin_related ENTH domain, Epsin Related fami 87.2
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 87.2
PF11864 464 DUF3384: Domain of unknown function (DUF3384); Int 87.03
PF12074339 DUF3554: Domain of unknown function (DUF3554); Int 86.97
cd03569142 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p s 86.94
PF04388 668 Hamartin: Hamartin protein; InterPro: IPR007483 Th 86.85
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 86.65
PF12530234 DUF3730: Protein of unknown function (DUF3730) ; I 86.63
cd03567139 VHS_GGA VHS domain family, GGA subfamily; GGA (Gol 86.22
KOG18511710 consensus Uncharacterized conserved protein [Funct 86.18
PF04388 668 Hamartin: Hamartin protein; InterPro: IPR007483 Th 85.83
KOG2011 1048 consensus Sister chromatid cohesion complex Cohesi 85.82
PF11701157 UNC45-central: Myosin-binding striated muscle asse 85.67
PF12783168 Sec7_N: Guanine nucleotide exchange factor in Golg 85.52
cd03561133 VHS VHS domain family; The VHS domain is present i 85.41
PF12231372 Rif1_N: Rap1-interacting factor 1 N terminal; Inte 85.36
PF0051441 Arm: Armadillo/beta-catenin-like repeat; InterPro: 85.08
PF11698119 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011 84.94
KOG0891 2341 consensus DNA-dependent protein kinase [Replicatio 84.87
KOG2256661 consensus Predicted protein involved in nuclear ex 84.82
KOG0929 1514 consensus Guanine nucleotide exchange factor [Intr 84.44
PF12333102 Ipi1_N: Rix1 complex component involved in 60S rib 84.32
smart00288133 VHS Domain present in VPS-27, Hrs and STAM. Unpubl 84.08
KOG3961262 consensus Uncharacterized conserved protein [Funct 83.81
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 83.48
PF12333102 Ipi1_N: Rix1 complex component involved in 60S rib 83.38
KOG2759442 consensus Vacuolar H+-ATPase V1 sector, subunit H 83.01
PF00790140 VHS: VHS domain; InterPro: IPR002014 The VHS domai 81.99
cd00197115 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamil 81.38
PF08389148 Xpo1: Exportin 1-like protein; InterPro: IPR013598 81.38
PF11935239 DUF3453: Domain of unknown function (DUF3453); Int 81.37
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information 
Probab=100.00  E-value=1.2e-64  Score=473.20  Aligned_cols=427  Identities=53%  Similarity=0.912  Sum_probs=398.3

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhhcCCcHHHHHHHHHhhccCCCHHHHHHHHHHHHHHHHhh
Q 013663            3 TSVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTA   82 (438)
Q Consensus         3 ~~~~~~~~~~~~~~l~~~l~~~~s~d~~~~r~~A~~~L~~~~~~p~~~~~l~~il~~~~~~~~~~R~~A~~~Lk~~i~~~   82 (438)
                      +.|+|.|+++.++|+.++|...+|||++ +|+.+...++++...|+|..+|.++|...++.+..+|.+|+.+|||.++-+
T Consensus         1 ~~~~w~p~e~~l~ql~~lLk~s~Spn~~-~~~~~~~~leq~~~~pdfnnYL~~IL~~~~~~d~~~Rs~aGLlLKNnvr~~   79 (885)
T KOG2023|consen    1 MAMTWQPDEQGLQQLAQLLKNSQSPNSE-TRNNVQEKLEQFNLFPDFNNYLIYILIRAKSEDVPTRSLAGLLLKNNVRGH   79 (885)
T ss_pred             CCCCCcccHHHHHHHHHHHHhccCCChH-HHHHHHHHHHHHhcccchhceeeEEEecccccchhHHHHhhhhHhcccccc
Confidence            3589999999999999999999999999 999999999999999999999999999878999999999999999999999


Q ss_pred             hccCCHhhHHHHHHHhhhhhhcCcHHHHHHHHHHHHHHHHhhccCchHHHHHHHHHHhccCChhhHhHHHHHHHHHHhcc
Q 013663           83 YKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDI  162 (438)
Q Consensus        83 w~~l~~~~~~~i~~~ll~~l~~~~~~vr~~~a~~la~i~~~~~~~~w~~ll~~l~~~l~~~~~~~r~~al~~l~~l~~~~  162 (438)
                      |..++++...++|+.+++.++++++-||...+.+|..|+...+...||+++|.|.+.+.+++.+..++|+.+|+.+|++.
T Consensus        80 ~~~~~~~~~~yiKs~~l~~lgd~~~lIr~tvGivITTI~s~~~~~~wpelLp~L~~~L~s~d~n~~EgA~~AL~KIcEDs  159 (885)
T KOG2023|consen   80 YNSIPSEVLDYIKSECLHGLGDASPLIRATVGIVITTIASTGGLQHWPELLPQLCELLDSPDYNTCEGAFGALQKICEDS  159 (885)
T ss_pred             ccCCChHHHHHHHHHHHhhccCchHHHHhhhhheeeeeecccccccchhHHHHHHHHhcCCcccccchhHHHHHHHHhhh
Confidence            99999999999999999999999999999999999999998889999999999999999999999999999999999999


Q ss_pred             ccccccCCCCCCcchhhhHHHHHHHhccCCCHHHHHHHHHHHHHHHcccchhhHHhHHHHHHHHHHhhCCCCHHHHHHHH
Q 013663          163 PQVLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVC  242 (438)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~il~~l~~~l~~~~~~vr~~al~~l~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~~~~~a~  242 (438)
                      ...+++++.   .+-++.++|.|++.+.++++++|..|+.|++.++-..++.+..++..++..++.+.+|++++||++.|
T Consensus       160 a~~lds~~~---~rpl~~mipkfl~f~~h~spkiRs~A~~cvNq~i~~~~qal~~~iD~Fle~lFalanD~~~eVRk~vC  236 (885)
T KOG2023|consen  160 AQFLDSDVL---TRPLNIMIPKFLQFFKHPSPKIRSHAVGCVNQFIIIQTQALYVHIDKFLEILFALANDEDPEVRKNVC  236 (885)
T ss_pred             HHHHhhhcc---cCchHHhHHHHHHHHhCCChhHHHHHHhhhhheeecCcHHHHHHHHHHHHHHHHHccCCCHHHHHHHH
Confidence            998876533   45689999999999999999999999999999998888889899999999999999999999999999


Q ss_pred             HHHHHHHhhCcccccccHHHHHHHHhhhhcCCChHHHhHHHHHHHHhhccCCChhhHHhhHHHHHHHHHhccCcChhhhh
Q 013663          243 AAFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDES  322 (438)
Q Consensus       243 ~~l~~l~~~~~~~~~~~~~~li~~~~~~~~~~~~~v~~~a~~~~~~~~~~~~~~~~~~~~l~~l~~~l~~~l~~~~~d~~  322 (438)
                      .+|.-+.+.+|+.+.||++.+++++++..++.+++|...|+|||.++++.+..+..+.||+++++|+|+..|.+.++|+-
T Consensus       237 ~alv~Llevr~dkl~phl~~IveyML~~tqd~dE~VALEACEFwla~aeqpi~~~~L~p~l~kliPvLl~~M~Ysd~D~~  316 (885)
T KOG2023|consen  237 RALVFLLEVRPDKLVPHLDNIVEYMLQRTQDVDENVALEACEFWLALAEQPICKEVLQPYLDKLIPVLLSGMVYSDDDII  316 (885)
T ss_pred             HHHHHHHHhcHHhcccchHHHHHHHHHHccCcchhHHHHHHHHHHHHhcCcCcHHHHHHHHHHHHHHHHccCccccccHH
Confidence            99999999999999999999999999999999999999999999999999877788999999999999999999998887


Q ss_pred             hcc-ccccCCCCCCCCCCCCccccCCCCCCCC-------C--CCCccccccchhhhhhHHHHHHHHHhhhchhhHHhHHH
Q 013663          323 LVE-AEEDESLPDRDQDLKPRFHSSRLHGSEN-------P--EDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMP  392 (438)
Q Consensus       323 ~~~-~~~~~~~~d~~~~i~~~~~~~~~~~~~~-------~--~~~d~~~~~~~~~r~~a~~~l~~l~~~~~~~~~~~l~~  392 (438)
                      +.+ .++|++++|++++|||+|+.++..|..+       +  ++||||....|++|++.+.+|+.++..+|++++|.++|
T Consensus       317 LL~~~eeD~~vpDreeDIkPRfhksk~~~~~~~~~~eDdddDe~DDdD~~~dWNLRkCSAAaLDVLanvf~~elL~~l~P  396 (885)
T KOG2023|consen  317 LLKNNEEDESVPDREEDIKPRFHKSKEHGNGEDADDEDDDDDEDDDDDAFSDWNLRKCSAAALDVLANVFGDELLPILLP  396 (885)
T ss_pred             HhcCccccccCCchhhhccchhhhchhccCccccccccccccccccccccccccHhhccHHHHHHHHHhhHHHHHHHHHH
Confidence            665 6788999999999999999987655411       1  12334456689999999999999999999999999999


Q ss_pred             HHHHHhccCCCCcchhhHHHHHHHHHHhhcchhhhhhccccccc
Q 013663          393 VIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIF  436 (438)
Q Consensus       393 ~l~~~l~~~~~~~w~~r~aal~~l~~l~~~~~~~~~~~l~~i~~  436 (438)
                      ++...+.+.+   |++|||+++++|+|||||.+.+.||||.++.
T Consensus       397 lLk~~L~~~~---W~vrEagvLAlGAIAEGcM~g~~p~LpeLip  437 (885)
T KOG2023|consen  397 LLKEHLSSEE---WKVREAGVLALGAIAEGCMQGFVPHLPELIP  437 (885)
T ss_pred             HHHHHcCcch---hhhhhhhHHHHHHHHHHHhhhcccchHHHHH
Confidence            9999999988   9999999999999999999999999998875

>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5657 CSE1 CAS/CSE protein involved in chromosome segregation [Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2171 consensus Karyopherin (importin) beta 3 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only] Back     alignment and domain information
>KOG1241 consensus Karyopherin (importin) beta 1 [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5101 CRM1 Importin beta-related nuclear transport receptor [Nuclear structure / Intracellular trafficking and secretion] Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1242 consensus Protein containing adaptin N-terminal region [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PRK09687 putative lyase; Provisional Back     alignment and domain information
>KOG2020 consensus Nuclear transport receptor CRM1/MSN5 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF01602 Adaptin_N: Adaptin N terminal region; InterPro: IPR002553 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0166 consensus Karyopherin (importin) alpha [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF03810 IBN_N: Importin-beta N-terminal domain; InterPro: IPR001494 Karyopherins are a group of proteins involved in transporting molecules through the pores of the nuclear envelope Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PTZ00429 beta-adaptin; Provisional Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PF10508 Proteasom_PSMB: Proteasome non-ATPase 26S subunit; InterPro: IPR019538 The 26S proteasome is an enzymatic complex that degrades ubiquitinated proteins in eukaryotic cells Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>COG5215 KAP95 Karyopherin (importin) beta [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0212 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0213 consensus Splicing factor 3b, subunit 1 [RNA processing and modification] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12348 CLASP_N: CLASP N terminal; InterPro: IPR024395 This domain is found in the N-terminal region of CLIP-associated proteins (CLASPs), which are widely conserved microtubule plus-end-tracking proteins that regulate the stability of dynamic microtubules [, ] Back     alignment and domain information
>KOG0915 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1410 consensus Nuclear transport receptor RanBP16 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12755 Vac14_Fab1_bd: Vacuolar 14 Fab1-binding region Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12460 MMS19_C: RNAPII transcription regulator C-terminal; InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5181 HSH155 U2 snRNP spliceosome subunit [RNA processing and modification] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG0211 consensus Protein phosphatase 2A regulatory subunit A and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] Back     alignment and domain information
>PF12717 Cnd1: non-SMC mitotic condensation complex subunit 1 Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG1248 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2956 consensus CLIP-associating protein [General function prediction only] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00020 ARM Armadillo/beta-catenin-like repeats Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1059 consensus Vesicle coat complex AP-3, delta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5064 SRP1 Karyopherin (importin) alpha [Intracellular trafficking and secretion] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1967 consensus DNA repair/transcription protein Mms19 [Replication, recombination and repair; Transcription] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>KOG1062 consensus Vesicle coat complex AP-1, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4224 consensus Armadillo repeat protein VAC8 required for vacuole fusion, inheritance and cytosol-to-vacuole protein targeting [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1943 consensus Beta-tubulin folding cofactor D [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2259 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>KOG4653 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2274 consensus Predicted importin 9 [Intracellular trafficking, secretion, and vesicular transport; Nuclear structure] Back     alignment and domain information
>PF04826 Arm_2: Armadillo-like; InterPro: IPR006911 This entry consists of mammalian proteins of unknown function Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1077 consensus Vesicle coat complex AP-2, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1060 consensus Vesicle coat complex AP-3, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>PF05918 API5: Apoptosis inhibitory protein 5 (API5); InterPro: IPR008383 This family consists of apoptosis inhibitory protein 5 (API5) sequences from several organisms Back     alignment and domain information
>KOG1820 consensus Microtubule-associated protein [Cytoskeleton] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>COG5240 SEC21 Vesicle coat complex COPI, gamma subunit [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1020 consensus Sister chromatid cohesion protein SCC2/Nipped-B [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning; Replication, recombination and repair] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>PF13646 HEAT_2: HEAT repeats; PDB: 1OYZ_A 3FGA_A 2PF4_C 2IAE_A 3B2A_A Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>KOG1993 consensus Nuclear transport receptor KAP120 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02270 conserved hypothetical protein Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF05004 IFRD: Interferon-related developmental regulator (IFRD); InterPro: IPR007701 Interferon-related developmental regulator (IFRD1) is the human homologue of the Rattus norvegicus early response protein PC4 and its murine homologue TIS7 [] Back     alignment and domain information
>PF13513 HEAT_EZ: HEAT-like repeat; PDB: 2Z5J_A 2OT8_B 2Z5O_A 2H4M_A 2QMR_A 1QBK_B 2Z5M_A 2Z5K_A 2Z5N_A 1GCJ_B Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1413 FOG: HEAT repeat [Energy production and conversion] Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF02985 HEAT: HEAT repeat; InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 [] Back     alignment and domain information
>COG5096 Vesicle coat complex, various subunits [Intracellular trafficking and secretion] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1058 consensus Vesicle coat complex COPI, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2025 consensus Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04510 DUF577: Family of unknown function (DUF577); InterPro: IPR007598 This is a family of Arabidopsis thaliana (Mouse-ear cress) proteins Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>KOG1061 consensus Vesicle coat complex AP-1/AP-2/AP-4, beta subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12719 Cnd3: Nuclear condensing complex subunits, C-term domain Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>PF08167 RIX1: rRNA processing/ribosome biogenesis Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>KOG2022 consensus Nuclear transport receptor LGL2 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14500 MMS19_N: Dos2-interacting transcription regulator of RNA-Pol-II Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>PF13251 DUF4042: Domain of unknown function (DUF4042) Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1992 consensus Nuclear export receptor CSE1/CAS (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PLN03076 ARF guanine nucleotide exchange factor (ARF-GEF); Provisional Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>KOG1078 consensus Vesicle coat complex COPI, gamma subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF08569 Mo25: Mo25-like; InterPro: IPR013878 Mo25-like proteins are involved in both polarised growth and cytokinesis Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG1517 consensus Guanine nucleotide binding protein MIP1 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>KOG2032 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>KOG0414 consensus Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF10363 DUF2435: Protein of unknown function (DUF2435) Back     alignment and domain information
>PF10274 ParcG: Parkin co-regulated protein; InterPro: IPR019399 This family of proteins is transcribed anti-sense along the DNA to the Parkin gene product and the two appear to be transcribed under the same promoter Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>PF05804 KAP: Kinesin-associated protein (KAP) Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0168 consensus Putative ubiquitin fusion degradation protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>KOG1949 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4535 consensus HEAT and armadillo repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1243 consensus Protein kinase [General function prediction only] Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>COG5218 YCG1 Chromosome condensation complex Condensin, subunit G [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4413 consensus 26S proteasome regulatory complex, subunit PSMD5 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5656 SXM1 Importin, protein involved in nuclear import [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF08064 UME: UME (NUC010) domain; InterPro: IPR012993 This domain is characteristic of UVSB PI-3 kinase, MEI-41 and ESR1 [] Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>KOG2149 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF13001 Ecm29: Proteasome stabiliser; InterPro: IPR024372 The proteasome (or macropain) (3 Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>PF08623 TIP120: TATA-binding protein interacting (TIP20); InterPro: IPR013932 TIP120 (also known as cullin-associated and neddylation-dissociated protein 1) is a TATA binding protein interacting protein that enhances transcription [] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG0392 consensus SNF2 family DNA-dependent ATPase domain-containing protein [Transcription] Back     alignment and domain information
>PF14664 RICTOR_N: Rapamycin-insensitive companion of mTOR, N-term Back     alignment and domain information
>KOG2062 consensus 26S proteasome regulatory complex, subunit RPN2/PSMD1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2933 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2021 consensus Nuclear mRNA export factor receptor LOS1/Exportin-t (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF07571 DUF1546: Protein of unknown function (DUF1546); InterPro: IPR011442 These proteins are associated with IPR004823 from INTERPRO in transcription initiation factor TFIID subunit 6 (TAF6) Back     alignment and domain information
>PF08506 Cse1: Cse1; InterPro: IPR013713 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF10521 DUF2454: Protein of unknown function (DUF2454); InterPro: IPR018870 Putative protein of unknown function; subunit of the ASTRA complex which is part of the chromatin remodeling machinery; similar to Schizosaccharomyces pombe (Fission yeast) Tti2p; may interact with Rsm23p [] Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>smart00802 UME Domain in UVSB PI-3 kinase, MEI-41 and ESR-1 Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2160 consensus Armadillo/beta-catenin-like repeat-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03378 CAS_CSE1: CAS/CSE protein, C-terminus; InterPro: IPR005043 Mammalian cellular apoptosis susceptibility (CAS) proteins and the yeast chromosome-segregation protein, CSE1 are homologous [] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG1293 consensus Proteins containing armadillo/beta-catenin-like repeat [General function prediction only] Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>COG5116 RPN2 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF11865 DUF3385: Domain of unknown function (DUF3385); InterPro: IPR024585 This uncharacterised domain is is typically between 160 to 172 amino acids in length Back     alignment and domain information
>PF05536 Neurochondrin: Neurochondrin Back     alignment and domain information
>KOG1525 consensus Sister chromatid cohesion complex Cohesin, subunit PDS5 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF08767 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES) Back     alignment and domain information
>PF01603 B56: Protein phosphatase 2A regulatory B subunit (B56 family); InterPro: IPR002554 Protein phosphatase 2A (PP2A) is a major intracellular protein phosphatase that regulates multiple aspects of cell growth and metabolism Back     alignment and domain information
>KOG2081 consensus Nuclear transport regulator [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>cd08050 TAF6 TATA Binding Protein (TBP) Associated Factor 6 (TAF6) is one of several TAFs that bind TBP and is involved in forming Transcription Factor IID (TFIID) complex Back     alignment and domain information
>COG5098 Chromosome condensation complex Condensin, subunit D2 [Chromatin structure and dynamics / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2549 consensus Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF01347 Vitellogenin_N: Lipoprotein amino terminal region; InterPro: IPR001747 This entry represents a conserved region found in several lipid transport proteins, including vitellogenin, microsomal triglyceride transfer protein and apolipoprotein B-100 [] Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>PF03224 V-ATPase_H_N: V-ATPase subunit H; InterPro: IPR004908 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1822 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF08767 CRM1_C: CRM1 C terminal; InterPro: IPR014877 CRM1 (also known as Exportin1) mediates the nuclear export of proteins bearing a leucine-rich nuclear export signal (NES) Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0946 consensus ER-Golgi vesicle-tethering protein p115 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04118 Dopey_N: Dopey, N-terminal; InterPro: IPR007249 DopA is the founding member of the Dopey family and is required for correct cell morphology and spatiotemporal organisation of multicellular structures in the filamentous fungus Emericella nidulans (Aspergillus nidulans) Back     alignment and domain information
>KOG0567 consensus HEAT repeat-containing protein [General function prediction only] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>KOG2137 consensus Protein kinase [Signal transduction mechanisms] Back     alignment and domain information
>cd00256 VATPase_H VATPase_H, regulatory vacuolar ATP synthase subunit H (Vma13p); activation component of the peripheral V1 complex of V-ATPase, a heteromultimeric enzyme which uses ATP to actively transport protons into organelles and extracellular compartments Back     alignment and domain information
>smart00638 LPD_N Lipoprotein N-terminal Domain Back     alignment and domain information
>COG5095 TAF6 Transcription initiation factor TFIID, subunit TAF6 (also component of histone acetyltransferase SAGA) [Transcription] Back     alignment and domain information
>PF12054 DUF3535: Domain of unknown function (DUF3535); InterPro: IPR022707 This presumed domain is functionally uncharacterised Back     alignment and domain information
>KOG4500 consensus Rho/Rac GTPase guanine nucleotide exchange factor smgGDS/Vimar [Signal transduction mechanisms] Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>PF11707 Npa1: Ribosome 60S biogenesis N-terminal; InterPro: IPR021714 Npa1p is required for ribosome biogenesis and operates in the same functional environment as Rsa3p and Dbp6p during early maturation of 60S ribosomal subunits [] Back     alignment and domain information
>PF09324 DUF1981: Domain of unknown function (DUF1981); InterPro: IPR015403 This domain is functionally uncharacterised and found in various plant and yeast protein transport proteins Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>PF12765 Cohesin_HEAT: HEAT repeat associated with sister chromatid cohesion Back     alignment and domain information
>PF12783 Sec7_N: Guanine nucleotide exchange factor in Golgi transport N-terminal Back     alignment and domain information
>cd03568 VHS_STAM VHS domain family, STAM subfamily; members include STAM (Signal Transducing Adaptor Molecule), EAST (EGFR-associated protein with SH3 and TAM domains) and Hbp (Hrs-binding protein) Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>KOG1851 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>KOG1837 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0413 consensus Uncharacterized conserved protein related to condensin complex subunit 1 [Function unknown] Back     alignment and domain information
>KOG3961 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF12830 Nipped-B_C: Sister chromatid cohesion C-terminus Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF08713 DNA_alkylation: DNA alkylation repair enzyme; InterPro: IPR014825 These proteins are predicted to be DNA alkylation repair enzymes Back     alignment and domain information
>KOG0929 consensus Guanine nucleotide exchange factor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF04078 Rcd1: Cell differentiation family, Rcd1-like ; InterPro: IPR007216 Rcd1 (Required cell differentiation 1) -like proteins are found among a wide range of organisms [] Back     alignment and domain information
>KOG0803 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03572 ENTH_epsin_related ENTH domain, Epsin Related family; composed of hypothetical proteins containing an ENTH-like domain Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF11864 DUF3384: Domain of unknown function (DUF3384); InterPro: IPR024584 This entry represents the N-terminal domain of tuberin which is functionally uncharacterised Back     alignment and domain information
>PF12074 DUF3554: Domain of unknown function (DUF3554); InterPro: IPR022716 This presumed domain is functionally uncharacterised Back     alignment and domain information
>cd03569 VHS_Hrs_Vps27p VHS domain family, Hrs and Vps27p subfamily; composed of Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and its yeast homolog Vps27p (vacuolar protein sorting) Back     alignment and domain information
>PF04388 Hamartin: Hamartin protein; InterPro: IPR007483 This family includes the hamartin protein which is thought to function as a tumour suppressor Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>PF12530 DUF3730: Protein of unknown function (DUF3730) ; InterPro: IPR022542 This domain is found in eukaryotes, and is typically between 220 and 262 amino acids in length Back     alignment and domain information
>cd03567 VHS_GGA VHS domain family, GGA subfamily; GGA (Golgi-localized, Gamma-ear-containing, Arf-binding) comprise a subfamily of ubiquitously expressed, monomeric, motif-binding cargo/clathrin adaptor proteins Back     alignment and domain information
>KOG1851 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF04388 Hamartin: Hamartin protein; InterPro: IPR007483 This family includes the hamartin protein which is thought to function as a tumour suppressor Back     alignment and domain information
>KOG2011 consensus Sister chromatid cohesion complex Cohesin, subunit STAG/IRR1/SCC3 [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF11701 UNC45-central: Myosin-binding striated muscle assembly central; InterPro: IPR024660 The UNC-45 or small muscle protein 1 of Caenorhabditis elegans is expressed in two forms from different genomic positions in mammals: as a general tissue protein (UNC-45a) and as a specific form (UNC-45b) expressed only in striated and skeletal muscle Back     alignment and domain information
>PF12783 Sec7_N: Guanine nucleotide exchange factor in Golgi transport N-terminal Back     alignment and domain information
>cd03561 VHS VHS domain family; The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule) Back     alignment and domain information
>PF12231 Rif1_N: Rap1-interacting factor 1 N terminal; InterPro: IPR022031 This domain family is found in eukaryotes, and is typically between 135 and 146 amino acids in length Back     alignment and domain information
>PF00514 Arm: Armadillo/beta-catenin-like repeat; InterPro: IPR000225 The armadillo (Arm) repeat is an approximately 40 amino acid long tandemly repeated sequence motif first identified in the Drosophila melanogaster segment polarity gene armadillo involved in signal transduction through wingless Back     alignment and domain information
>PF11698 V-ATPase_H_C: V-ATPase subunit H; InterPro: IPR011987 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG0891 consensus DNA-dependent protein kinase [Replication, recombination and repair] Back     alignment and domain information
>KOG2256 consensus Predicted protein involved in nuclear export of pre-ribosomes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0929 consensus Guanine nucleotide exchange factor [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF12333 Ipi1_N: Rix1 complex component involved in 60S ribosome maturation; InterPro: IPR024679 This domain is found in IPI1, which is a component of the Rix1 complex involved in pre-rRNA-processing [, ] Back     alignment and domain information
>smart00288 VHS Domain present in VPS-27, Hrs and STAM Back     alignment and domain information
>KOG3961 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>PF12333 Ipi1_N: Rix1 complex component involved in 60S ribosome maturation; InterPro: IPR024679 This domain is found in IPI1, which is a component of the Rix1 complex involved in pre-rRNA-processing [, ] Back     alignment and domain information
>KOG2759 consensus Vacuolar H+-ATPase V1 sector, subunit H [Energy production and conversion] Back     alignment and domain information
>PF00790 VHS: VHS domain; InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM Back     alignment and domain information
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain Back     alignment and domain information
>PF08389 Xpo1: Exportin 1-like protein; InterPro: IPR013598 The exchange of macromolecules between the nucleus and cytoplasm takes place through nuclear pore complexes within the nuclear membrane Back     alignment and domain information
>PF11935 DUF3453: Domain of unknown function (DUF3453); InterPro: IPR021850 This presumed domain is functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
2qmr_A 890 Karyopherin Beta2TRANSPORTIN Length = 890 1e-89
1qbk_B 890 Structure Of The Karyopherin Beta2-ran Gppnhp Nucle 6e-86
2h4m_A 865 Karyopherin Beta2TRANSPORTIN-M9nls Length = 865 7e-86
2ot8_A 852 Karyopherin Beta2TRANSPORTIN-Hnrnpm Nls Complex Len 1e-81
1ukl_A 876 Crystal Structure Of Importin-Beta And Srebp-2 Comp 7e-11
1ibr_D462 Complex Of Ran With Importin Beta Length = 462 2e-10
1m5n_S485 Crystal Structure Of Heat Repeats (1-11) Of Importi 2e-10
3nd2_A 861 Structure Of Yeast Importin-Beta (Kap95p) Length = 3e-10
1f59_A442 Importin-Beta-Fxfg Nucleoporin Complex Length = 442 3e-10
2bpt_A 861 Structure Of The Nup1p:kap95p Complex Length = 861 4e-10
2p8q_A 876 Crystal Structure Of Human Importin Beta Bound To T 5e-10
1qgk_A 876 Structure Of Importin Beta Bound To The Ibb Domain 6e-10
1gcj_A460 N-Terminal Fragment Of Importin-Beta Length = 460 2e-09
2qna_A 762 Crystal Structure Of Human Importin-Beta (127-876) 4e-05
>pdb|2QMR|A Chain A, Karyopherin Beta2TRANSPORTIN Length = 890 Back     alignment and structure 
Iteration: 1

 Score =  326 bits (836), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 185/443 (41%), Positives = 275/443 (62%), Gaps = 21/443 (4%)
Query: 7   WQPQEQGFNEICRLLEQQISPSSTADKSXXXXXXXXXXXFPDFNNYLAFILARAEGKSVE 66
           W+P EQG  +I +LL++  SP +T  ++           +PDFNNYL F+L + + +   
Sbjct: 5   WKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQ-YPDFNNYLIFVLTKLKSEDEP 63
Query: 67  IRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGI 126
            R  +GL+LKNN++  +++       +IKSE L  +G +   IR+TVG +++ +   G +
Sbjct: 64  TRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGEL 123
Query: 127 AGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLL 186
             W +LL  L + LDS D N  EGA  AL KICED  ++LDSDV    + P+NI +P+ L
Sbjct: 124 QNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDV---LDRPLNIMIPKFL 180
Query: 187 QFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFN 246
           QFF+     +R  ++  VNQFI+    AL + +D +++ LF L+ D   EVRK VC A  
Sbjct: 181 QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV 240
Query: 247 LLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRL 306
           +L+EVR   L PH+ N+ EYMLQ  +D D++VALEACEFW +  E  +  + L   LP+L
Sbjct: 241 MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL 300
Query: 307 VPVLLSNMIYADDDESLVEA--EEDESLPDRDQDLKPRFHSSRLHGSEN----------- 353
           +PVL++ M Y+D D  L++   EEDE++PD +QD++PRFH SR    ++           
Sbjct: 301 IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDD 360
Query: 354 -PEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAA 412
             E DDDD ++ WNLRKCSAAALDVL+NV+ DE+LP ++P+++  L       W  +E+ 
Sbjct: 361 DDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLF---HHEWVVKESG 417
Query: 413 VLALGAIAEGCIKGLYPHLSEVI 435
           +L LGAIAEGC++G+ P+L E+I
Sbjct: 418 ILVLGAIAEGCMQGMIPYLPELI 440
>pdb|1QBK|B Chain B, Structure Of The Karyopherin Beta2-ran Gppnhp Nuclear Transport Complex Length = 890 Back     alignment and structure
>pdb|2H4M|A Chain A, Karyopherin Beta2TRANSPORTIN-M9nls Length = 865 Back     alignment and structure
>pdb|2OT8|A Chain A, Karyopherin Beta2TRANSPORTIN-Hnrnpm Nls Complex Length = 852 Back     alignment and structure
>pdb|1UKL|A Chain A, Crystal Structure Of Importin-Beta And Srebp-2 Complex Length = 876 Back     alignment and structure
>pdb|1IBR|D Chain D, Complex Of Ran With Importin Beta Length = 462 Back     alignment and structure
>pdb|1M5N|S Chain S, Crystal Structure Of Heat Repeats (1-11) Of Importin B Bound To The Non-Classical Nls(67-94) Of Pthrp Length = 485 Back     alignment and structure
>pdb|3ND2|A Chain A, Structure Of Yeast Importin-Beta (Kap95p) Length = 861 Back     alignment and structure
>pdb|1F59|A Chain A, Importin-Beta-Fxfg Nucleoporin Complex Length = 442 Back     alignment and structure
>pdb|2BPT|A Chain A, Structure Of The Nup1p:kap95p Complex Length = 861 Back     alignment and structure
>pdb|2P8Q|A Chain A, Crystal Structure Of Human Importin Beta Bound To The Snurportin1 Ibb- Domain Length = 876 Back     alignment and structure
>pdb|1QGK|A Chain A, Structure Of Importin Beta Bound To The Ibb Domain Of Importin Alpha Length = 876 Back     alignment and structure
>pdb|1GCJ|A Chain A, N-Terminal Fragment Of Importin-Beta Length = 460 Back     alignment and structure
>pdb|2QNA|A Chain A, Crystal Structure Of Human Importin-Beta (127-876) In Complex With The Ibb-Domain Of Snurportin1 (1-65) Length = 762 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 1e-106
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 5e-19
4fdd_A852 Transportin-1; heat repeats, karyopherin, nuclear 1e-09
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 1e-67
1qgr_A 876 Protein (importin beta subunit); transport recepto 4e-65
1qgr_A 876 Protein (importin beta subunit); transport recepto 2e-06
1qgr_A 876 Protein (importin beta subunit); transport recepto 2e-04
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 1e-62
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 3e-31
1u6g_C1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 6e-13
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 4e-11
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 7e-08
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 2e-27
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 8e-19
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 4e-17
2x19_B 963 Importin-13; nuclear transport, protein transport; 1e-16
2x1g_F 971 Cadmus; transport protein, developmental protein, 2e-16
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 3e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 2e-10
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 2e-09
1b3u_A588 Protein (protein phosphatase PP2A); scaffold prote 3e-06
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 2e-10
2db0_A253 253AA long hypothetical protein; heat repeats, hel 3e-06
2db0_A253 253AA long hypothetical protein; heat repeats, hel 3e-04
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 5e-04
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
 Score =  333 bits (855), Expect = e-106
 Identities = 172/432 (39%), Positives = 259/432 (59%), Gaps = 31/432 (7%)

Query: 4   SVAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGK 63
              W+P EQG  +I +LL++  SP  T  +  + Q+L+Q +Q+PDFNNYL F+L + + +
Sbjct: 2   EYEWKPDEQGLQQILQLLKESQSPD-TTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE 60

Query: 64  SVEIRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQL 123
               R  +GL+LKNN++  +++       +IKSE L  +G +   IR+TVG +++ +   
Sbjct: 61  DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK 120

Query: 124 GGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLP 183
           G +  W +LL  L + LDS D N  EGA  AL KICED  ++LDSDV    + P+NI +P
Sbjct: 121 GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDV---LDRPLNIMIP 177

Query: 184 RLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCA 243
           + LQFF+     +R  ++  VNQFI+    AL + +D +++ LF L+ D   EVRK VC 
Sbjct: 178 KFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCR 237

Query: 244 AFNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFL 303
           A  +L+EVR   L PH+ N+ EYMLQ  +D D++VALEACEFW +  E  +  + L   L
Sbjct: 238 ALVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHL 297

Query: 304 PRLVPVLLSNMIYADDDESLVEAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVN 363
           P+L+PVL++ M Y+D D  L++ + +                             DD ++
Sbjct: 298 PKLIPVLVNGMKYSDIDIILLKGDVEG------------------------GSGGDDTIS 333

Query: 364 VWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAAVLALGAIAEGC 423
            WNLRKCSAAALDVL+NV+ DE+LP ++P+++  L       W  +E+ +L LGAIAEGC
Sbjct: 334 DWNLRKCSAAALDVLANVYRDELLPHILPLLKELLF---HHEWVVKESGILVLGAIAEGC 390

Query: 424 IKGLYPHLSEVI 435
           ++G+ P+L E+I
Sbjct: 391 MQGMIPYLPELI 402
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Length = 852 Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Length = 861 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Length = 876 Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Length = 462 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Length = 1230 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Length = 960 Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Length = 1073 Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Length = 980 Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Length = 963 Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Length = 971 Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Length = 1049 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Length = 588 Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Length = 1204 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Length = 253 Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Length = 242 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 100.0
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 100.0
2bpt_A 861 Importin beta-1 subunit; nuclear transport, nucleo 100.0
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 100.0
1qgr_A 876 Protein (importin beta subunit); transport recepto 100.0
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 100.0
2x19_B 963 Importin-13; nuclear transport, protein transport; 100.0
2x1g_F 971 Cadmus; transport protein, developmental protein, 100.0
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 99.97
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 99.97
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 99.96
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 99.95
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.95
4fdd_A 852 Transportin-1; heat repeats, karyopherin, nuclear 99.88
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.86
1b3u_A 588 Protein (protein phosphatase PP2A); scaffold prote 99.85
2bpt_A861 Importin beta-1 subunit; nuclear transport, nucleo 99.83
1u6g_C 1230 TIP120 protein, CAND1; cullin repeat, heat repeat, 99.81
1qgr_A 876 Protein (importin beta subunit); transport recepto 99.81
1ibr_B462 P95, importin beta-1 subunit, nuclear factor; smal 99.78
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.74
1wa5_B530 Importin alpha subunit; nuclear transport/complex, 99.72
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.7
4b8j_A528 Importin subunit alpha-1A; transport protein, nucl 99.69
2jdq_A450 Importin alpha-1 subunit; transport, PB2 subunit, 99.66
1wa5_B 530 Importin alpha subunit; nuclear transport/complex, 99.63
4b8j_A 528 Importin subunit alpha-1A; transport protein, nucl 99.58
3ul1_B510 Importin subunit alpha-2; arm repeat, armadillo re 99.58
2vgl_B 591 AP-2 complex subunit beta-1; cytoplasmic vesicle, 99.57
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.56
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.56
2qk2_A242 LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2 99.55
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.51
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.48
2qk1_A249 Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, h 99.47
1w63_A 618 Adapter-related protein complex 1 gamma 1 subunit; 99.47
1wa5_C 960 Importin alpha RE-exporter; nuclear transport/comp 99.38
3tpo_A529 Importin subunit alpha-2; nuclear import, protein 99.37
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.37
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.36
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.36
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.34
4hxt_A252 De novo protein OR329; structural genomics, PSI-bi 99.34
3ul1_B 510 Importin subunit alpha-2; arm repeat, armadillo re 99.32
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.32
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.32
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.31
1oyz_A280 Hypothetical protein YIBA; structural genomics, PS 99.31
3now_A810 UNC-45 protein, SD10334P; armadillo repeat, HSP90, 99.3
1jdh_A 529 Beta-catenin; beta-catenin, protein-protein comple 99.29
2x19_B 963 Importin-13; nuclear transport, protein transport; 99.27
2z6g_A 780 B-catenin; FULL-length, beta-catenin, cell adhesio 99.26
2x1g_F 971 Cadmus; transport protein, developmental protein, 99.25
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.2
4db8_A252 Armadillo-repeat protein; solenoid repeat, de novo 99.2
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.15
1jdh_A529 Beta-catenin; beta-catenin, protein-protein comple 99.14
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.13
3ltm_A211 Alpha-REP4; protein engineering, heat-like repeat, 99.13
2vgl_A 621 Adaptor protein complex AP-2, alpha 2 subunit; cyt 99.12
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.1
4db6_A210 Armadillo repeat protein; solenoid repeat, armadil 99.09
3ltj_A201 Alpharep-4; protein engineering, heat-like repeat, 99.08
2z6h_A 644 Catenin beta-1, beta-catenin; C-terminal domain, a 99.06
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 99.02
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 99.02
3nmz_A458 APC variant protein; protein-protein complex, arma 98.99
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 98.92
3l6x_A584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.79
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.78
3ibv_A 980 Exportin-T; karyopherin, heat repeat, cytoplasm, n 98.78
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.75
2db0_A253 253AA long hypothetical protein; heat repeats, hel 98.73
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.71
3m1i_C 1049 Exportin-1; heat repeat, GTP-binding, nucleotide-b 98.7
1xqr_A296 HSPBP1 protein; armadillo repeat, superhelical twi 98.69
4hat_C 1023 Exportin-1; heat repeat, nuclear export, RAN-ranbp 98.65
1xm9_A457 Plakophilin 1; armadillo repeat, cell adhesion; 2. 98.64
3l6x_A 584 Catenin delta-1; catenin, armadillo, ARM, JMD, CE 98.61
3nmz_A458 APC variant protein; protein-protein complex, arma 98.6
3tjz_B355 Coatomer subunit gamma; protein trafficking, golgi 98.57
3nmw_A354 APC variant protein; ARMADIILO repeats domain, cel 98.54
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.49
3b2a_A265 TON_1937, putative uncharacterized protein; heat-r 98.47
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.45
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.44
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.41
2of3_A266 ZYG-9; multifunctional macromolecule, kinetochore, 98.4
4ffb_C278 Protein STU2; tubulin fold, heat repeats, cytoskel 98.38
4ady_A 963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.3
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 98.19
4ady_A963 RPN2, 26S proteasome regulatory subunit RPN2; prot 98.13
3opb_A778 SWI5-dependent HO expression protein 4; heat and a 98.12
3gjx_A 1073 Exportin-1; transport, cytoplasm, nucleus, RNA-bin 97.97
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.85
3oc3_A 800 Helicase MOT1, MOT1; regulation of transcription, 97.74
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.69
3grl_A 651 General vesicular transport factor P115; vesicle t 97.67
1te4_A131 Conserved protein MTH187; methanobacterium thermoa 97.67
3l9t_A240 Putative uncharacterized protein SMU.31; hypotheti 97.47
3u0r_A 507 Apoptosis inhibitor 5; heat repeat, armadillo repe 97.36
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.34
3a6p_A 1204 Exportin-5; exportin-5, RANGTP, nuclearexport, imp 97.28
3tt9_A233 Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} 97.24
1vsy_4 799 Proteasome activator BLM10; 20S proteasome BLM10, 97.13
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 96.92
3grl_A 651 General vesicular transport factor P115; vesicle t 96.81
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 96.46
1vsy_5 997 Proteasome activator BLM10; 20S proteasome BLM10, 96.4
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 96.32
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 96.23
1vsy_5997 Proteasome activator BLM10; 20S proteasome BLM10, 96.22
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 96.21
1vsy_4 799 Proteasome activator BLM10; 20S proteasome BLM10, 96.06
3gs3_A257 Symplekin, LD45768P; helix-turn-helix heat repeat 95.9
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 95.78
4gmo_A 684 Putative uncharacterized protein; ARM, heat, solen 95.76
1upk_A341 MO25 protein; transferase, armadillo; HET: MSE; 1. 95.53
3fga_B403 Serine/threonine-protein phosphatase 2A 56 kDa RE 95.13
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 94.66
1w9c_A321 CRM1 protein, exportin 1; nuclear protein, nuclear 94.57
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 94.04
3o2t_A386 Symplekin; heat repeat, scaffold, protein binding; 93.73
1lsh_A 1056 Lipovitellin (LV-1N, LV-1C); vitellogenin, lipopro 93.56
1lrv_A244 LRV, leucine-rich repeat variant; leucine-rich rep 93.3
3u0r_A507 Apoptosis inhibitor 5; heat repeat, armadillo repe 92.39
3jxy_A232 Alkylpurine DNA glycosylase ALKD; heat repeat, DNA 91.32
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 90.58
4atg_A196 TAF6; transcription, TFIID; HET: NHE; 1.89A {Anton 89.81
1ho8_A480 Vacuolar ATP synthase subunit H; heat repeat, hydr 89.14
3g2s_A149 C-terminal fragment of sortilin-related receptor; 88.42
3g2s_A149 C-terminal fragment of sortilin-related receptor; 88.24
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 87.88
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 87.46
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 85.89
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 85.67
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 85.63
2fv2_A268 RCD1 required for cell differentiation1 homolog; a 85.54
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 85.22
1juq_A171 ADP-ribosylation factor binding protein GGA3; prot 85.2
2nsz_A129 Programmed cell death protein 4; PDCD4, tumor supp 84.96
1mhq_A148 ADP-ribosylation factor binding protein GGA2; supe 84.34
2npp_B449 PP2A, B subunit, serine/threonine-protein phosphat 84.27
3ldz_A140 STAM-1, signal transducing adapter molecule 1; ubi 84.02
1x5b_A163 Signal transducing adaptor molecule 2; VHS domain, 83.79
1w9c_A321 CRM1 protein, exportin 1; nuclear protein, nuclear 83.07
1sz9_A144 PCF11 protein; RNA polymerase II CTD interacting d 83.01
2b6c_A220 Hypothetical protein EF3068; structural genomis, D 81.08
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
Probab=100.00  E-value=6.7e-49  Score=415.89  Aligned_cols=401  Identities=43%  Similarity=0.784  Sum_probs=355.4

Q ss_pred             CCCCCCHHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhhcCCcHHHHHHHHHhhccCCCHHHHHHHHHHHHHHHHhhhc
Q 013663            5 VAWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYK   84 (438)
Q Consensus         5 ~~~~~~~~~~~~l~~~l~~~~s~d~~~~r~~A~~~L~~~~~~p~~~~~l~~il~~~~~~~~~~R~~A~~~Lk~~i~~~w~   84 (438)
                      |+|+|+++.++++.++|.+++|||++ +|++|+++|++++++|+++.+|.+++.+..+.++.+|++|+++|||.+.++|.
T Consensus         3 ~~w~~~~~~~~~l~~~l~~~~s~d~~-~r~~Ae~~L~~~~~~p~~~~~l~~il~~~~~~~~~vR~~a~~~Lkn~i~~~w~   81 (852)
T 4fdd_A            3 YEWKPDEQGLQQILQLLKESQSPDTT-IQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQ   81 (852)
T ss_dssp             --CCCCHHHHHHHHHHHHHHTCSCHH-HHHHHHHHHHHHTTSHHHHHHHHHHHHTCTTSCHHHHHHHHHHHHHHTTTSGG
T ss_pred             CCCCCChhhHHHHHHHHHHHhCcCHH-HHHHHHHHHHHHHhCCCHHHHHHHHHhccCCCChHHHHHHHHHHHHHHHHccC
Confidence            78999999999999999999999999 99999999999999999999999999843478999999999999999999999


Q ss_pred             cCCHhhHHHHHHHhhhhhhcCcHHHHHHHHHHHHHHHHhhccCchHHHHHHHHHHhccCChhhHhHHHHHHHHHHhcccc
Q 013663           85 SMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQ  164 (438)
Q Consensus        85 ~l~~~~~~~i~~~ll~~l~~~~~~vr~~~a~~la~i~~~~~~~~w~~ll~~l~~~l~~~~~~~r~~al~~l~~l~~~~~~  164 (438)
                      .++++.+..||+.+++.+.++++.||+.++.+++.|++.++++.||++++.+.+.+.++++.+|++++.+|+.+++..+.
T Consensus        82 ~~~~~~~~~ik~~ll~~l~~~~~~vr~~~a~~i~~ia~~~~~~~wp~ll~~L~~~l~~~~~~~r~~al~~L~~i~~~~~~  161 (852)
T 4fdd_A           82 NFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAE  161 (852)
T ss_dssp             GCCHHHHHHHHHHHHTTTTCSSHHHHHHHHHHHHHHHHHTTTTTCTTHHHHHHHHHSCSSHHHHHHHHHHHHHHHHHHTT
T ss_pred             CCCHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHhcCccccHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhHH
Confidence            99999999999999999999999999999999999999998899999999999999999999999999999999999887


Q ss_pred             ccccCCCCCCcchhhhHHHHHHHhccCCCHHHHHHHHHHHHHHHcccchhhHHhHHHHHHHHHHhhCCCCHHHHHHHHHH
Q 013663          165 VLDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAA  244 (438)
Q Consensus       165 ~~~~~~~~~~~~~~~~il~~l~~~l~~~~~~vr~~al~~l~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~~~~~a~~~  244 (438)
                      .+.++   .+...++.++|.+++++++++..||..|+++++.++...++.+.+.++.+++.++..++++++++|..++++
T Consensus       162 ~~~~~---~~~~~~~~il~~l~~~l~~~~~~vR~~A~~aL~~~~~~~~~~~~~~~~~~l~~l~~~~~d~~~~vr~~a~~~  238 (852)
T 4fdd_A          162 ILDSD---VLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRA  238 (852)
T ss_dssp             HHHHC---SSSSCHHHHHHHHTTTTTCSSHHHHHHHHHHHHTTTTTTCHHHHTSHHHHHHHHHHHHTCCCHHHHHHHHHH
T ss_pred             Hhchh---hhcchHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHhcccHHHHHHHHHHHHHHHHHcCCCCHHHHHHHHHH
Confidence            65421   112457889999999999999999999999999888777766777788899999999999999999999999


Q ss_pred             HHHHHhhCcccccccHHHHHHHHhhhhcCCChHHHhHHHHHHHHhhccCCChhhHHhhHHHHHHHHHhccCcChhhhhhc
Q 013663          245 FNLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLV  324 (438)
Q Consensus       245 l~~l~~~~~~~~~~~~~~li~~~~~~~~~~~~~v~~~a~~~~~~~~~~~~~~~~~~~~l~~l~~~l~~~l~~~~~d~~~~  324 (438)
                      |..+++.+|+.+.+|++.++++++..+++.++++|..|+++|.++++.+...+.+++++..++|.++..+...++|..|+
T Consensus       239 L~~l~~~~~~~~~~~l~~l~~~l~~~~~~~~~~vr~~a~e~l~~l~~~~~~~~~~~~~~~~l~p~ll~~l~~~e~d~~~~  318 (852)
T 4fdd_A          239 LVMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILL  318 (852)
T ss_dssp             HHHHHHHCHHHHGGGHHHHHHHHHHHHTCSSHHHHHHHHHHHHHHTTSTTHHHHHTTTHHHHHHHHHHHTSCCHHHHHHH
T ss_pred             HHHHHHhCHHHHHHHHHHHHHHHHHHccCCcHHHHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHcCCcHhHHHHh
Confidence            99999999999999999999999999999999999999999999998755566688999999999999999888887766


Q ss_pred             cccccCCCCCCCCCCCCccccCCCCCCCCCCCCccccccchhhhhhHHHHHHHHHhhhchhhHHhHHHHHHHHhccCCCC
Q 013663          325 EAEEDESLPDRDQDLKPRFHSSRLHGSENPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDE  404 (438)
Q Consensus       325 ~~~~~~~~~d~~~~i~~~~~~~~~~~~~~~~~~d~~~~~~~~~r~~a~~~l~~l~~~~~~~~~~~l~~~l~~~l~~~~~~  404 (438)
                      +.+.+                      +  +++|||....|++|++|..+|+.++..+|+.+++.++|++...+++++  
T Consensus       319 ~~d~~----------------------e--d~~~dd~~~~~~vr~~a~~~L~~la~~~~~~~~~~l~~~l~~~l~~~~--  372 (852)
T 4fdd_A          319 KGDVE----------------------G--GSGGDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHE--  372 (852)
T ss_dssp             HC------------------------------------CCCCHHHHHHHHHHHHHHHHGGGGHHHHHHHHHHHHTCSS--
T ss_pred             cCCcc----------------------c--ccccccccccchHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhcCCC--
Confidence            42210                      0  111111124799999999999999999999999999999999999888  


Q ss_pred             cchhhHHHHHHHHHHhhcchhhhhhccccccc
Q 013663          405 AWKDREAAVLALGAIAEGCIKGLYPHLSEVIF  436 (438)
Q Consensus       405 ~w~~r~aal~~l~~l~~~~~~~~~~~l~~i~~  436 (438)
                       |+.|++|+.++|.+++++++.+.++++.+++
T Consensus       373 -~~~R~aa~~alg~i~~~~~~~~~~~l~~~l~  403 (852)
T 4fdd_A          373 -WVVKESGILVLGAIAEGCMQGMIPYLPELIP  403 (852)
T ss_dssp             -HHHHHHHHHHHHHTTTTTHHHHGGGHHHHHH
T ss_pred             -HHHHHHHHHHHHHHHhcchHHHHHHHHHHHH
Confidence             9999999999999999999888888777654
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>4fdd_A Transportin-1; heat repeats, karyopherin, nuclear import, protein transport importin, transportin, transport protein; 2.30A {Homo sapiens} PDB: 2ot8_A 2h4m_A 2z5k_A 2z5j_A 2qmr_A 2z5m_A 2z5n_A 2z5o_A 1qbk_B* Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>1b3u_A Protein (protein phosphatase PP2A); scaffold protein, phosphorylation, heat repeat; 2.30A {Homo sapiens} SCOP: a.118.1.2 PDB: 2ie4_A* 2ie3_A* 2npp_A* 3k7v_A* 3k7w_A* 3fga_A* 2pf4_A 2iae_A 2nym_A* 2nyl_A* 3dw8_A* 2pkg_A 3c5w_A Back     alignment and structure
>2bpt_A Importin beta-1 subunit; nuclear transport, nucleocytoplasmic transport, nuclear trafficking, importin- beta, complex; 1.99A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 2bku_B 3ea5_B* 3nd2_A Back     alignment and structure
>1u6g_C TIP120 protein, CAND1; cullin repeat, heat repeat, ring finger, ligase; 3.10A {Homo sapiens} SCOP: a.118.1.2 PDB: 4a0c_A Back     alignment and structure
>1qgr_A Protein (importin beta subunit); transport receptor, nuclear import, heat motif, NLS-binding; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qgk_A 2p8q_A 2q5d_A 3lww_A 1ukl_A 2qna_A Back     alignment and structure
>1ibr_B P95, importin beta-1 subunit, nuclear factor; small GTPase, nuclear transport receptor, cell cycle, translation; HET: GNP; 2.30A {Homo sapiens} SCOP: a.118.1.1 PDB: 1m5n_S 1gcj_A 1f59_A 1o6o_A 1o6p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>2jdq_A Importin alpha-1 subunit; transport, PB2 subunit, nuclear protein, protein transport, armadillo repeats; 2.2A {Homo sapiens} PDB: 3tj3_A Back     alignment and structure
>1wa5_B Importin alpha subunit; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1un0_A 2c1t_A 1bk5_A 1ee5_A 1bk6_A 1ee4_A Back     alignment and structure
>4b8j_A Importin subunit alpha-1A; transport protein, nuclear localization signal; 2.00A {Oryza sativa japonica group} PDB: 4b8o_A 2yns_A 4b8p_A Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2vgl_B AP-2 complex subunit beta-1; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Homo sapiens} SCOP: i.23.1.1 PDB: 2jkt_B 2jkr_B* 2xa7_B 1w63_B Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qk2_A LP04448P; mini spindles, MSPS, XMAP215, DIS1, STU2, heat repeat, micro plus END, +TIP, protein binding; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2qk1_A Protein STU2; STU2P, XMAP215, DIS1, TOG, CH-TOG, heat repeat, microtubule plus END, +TIP, protein binding; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1w63_A Adapter-related protein complex 1 gamma 1 subunit; endocytosis, clathrin adaptor, transport, coated PITS; 4.0A {Mus musculus} SCOP: i.23.1.1 Back     alignment and structure
>1wa5_C Importin alpha RE-exporter; nuclear transport/complex, nuclear transport, exportin, RAN GTPase, protein transport; HET: GTP; 2.0A {Saccharomyces cerevisiae} SCOP: a.118.1.1 PDB: 1z3h_A Back     alignment and structure
>3tpo_A Importin subunit alpha-2; nuclear import, protein transport; 2.10A {Mus musculus} PDB: 1qgk_B 1qgr_B Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>4hxt_A De novo protein OR329; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.95A {Artificial gene} Back     alignment and structure
>3ul1_B Importin subunit alpha-2; arm repeat, armadillo repeat, nuclear transport, nuclear LOC signal binding, importin beta binding; 1.90A {Mus musculus} PDB: 3ukx_B 3uky_B 3ukz_B 3ukw_B 3ul0_B 3oqs_A 3rz9_A 3rzx_A 3uvu_A 1q1s_C 1q1t_C 3knd_A 1ejy_I 1iq1_C 1ejl_I 1pjn_B 1pjm_B 3q5u_A 3fey_C 3fex_C ... Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1oyz_A Hypothetical protein YIBA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.10A {Escherichia coli} SCOP: a.118.1.16 Back     alignment and structure
>3now_A UNC-45 protein, SD10334P; armadillo repeat, HSP90, myosin, tetra-tricopeptide repeat, binding protein required for myosin function; 2.99A {Drosophila melanogaster} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2x19_B Importin-13; nuclear transport, protein transport; HET: GTP; 2.80A {Homo sapiens} PDB: 2xwu_B Back     alignment and structure
>2z6g_A B-catenin; FULL-length, beta-catenin, cell adhesion; 3.40A {Danio rerio} Back     alignment and structure
>2x1g_F Cadmus; transport protein, developmental protein, mRNA processing, nuclear transport, mRNA splicing, mRNA transport; 3.35A {Drosophila melanogaster} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>4db8_A Armadillo-repeat protein; solenoid repeat, de novo protein; 2.50A {Synthetic construct} Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>1jdh_A Beta-catenin; beta-catenin, protein-protein complex, transcription; 1.90A {Homo sapiens} SCOP: a.118.1.1 PDB: 1qz7_A 1g3j_A 1th1_A* 1i7w_A* 1i7x_A 1jpp_A 1m1e_A 1v18_A* 3oux_A 3ouw_A 1jpw_A 3tx7_A* 2gl7_A 1t08_A 1luj_A 2bct_A 3bct_A* 3ifq_A* 3sla_A 3sl9_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3ltm_A Alpha-REP4; protein engineering, heat-like repeat, protein binding; HET: 1PE 12P; 2.15A {Synthetic} Back     alignment and structure
>2vgl_A Adaptor protein complex AP-2, alpha 2 subunit; cytoplasmic vesicle, alternative splicing, endocytosis, lipid-binding, golgi apparatus, adaptor, membrane, transport; HET: IHP; 2.59A {Rattus norvegicus} PDB: 2xa7_A 2jkr_A 2jkt_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>4db6_A Armadillo repeat protein; solenoid repeat, armadillo repeat motif, de novo protein; 1.80A {Synthetic construct} PDB: 4db9_A 4dba_A Back     alignment and structure
>3ltj_A Alpharep-4; protein engineering, heat-like repeat, protein binding; 1.80A {Synthetic} Back     alignment and structure
>2z6h_A Catenin beta-1, beta-catenin; C-terminal domain, activator, alternative splicing, cell adhesion, cytoplasm, cytoskeleton, disease mutation, nucleus; 2.20A {Homo sapiens} Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3ibv_A Exportin-T; karyopherin, heat repeat, cytoplasm, nucleus, RNA- binding, transport, tRNA processing, tRNA-binding, RNA binding protein; 3.10A {Schizosaccharomyces pombe} PDB: 3icq_T* Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>2db0_A 253AA long hypothetical protein; heat repeats, helical structure, structural genomics; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3m1i_C Exportin-1; heat repeat, GTP-binding, nucleotide-binding, NUCL protein transport, transport, cytoplasm, GTPase activation; HET: GTP; 2.00A {Saccharomyces cerevisiae} PDB: 2l1l_B Back     alignment and structure
>1xqr_A HSPBP1 protein; armadillo repeat, superhelical twist, chaperone; 2.10A {Homo sapiens} SCOP: a.118.1.21 PDB: 1xqs_A* Back     alignment and structure
>4hat_C Exportin-1; heat repeat, nuclear export, RAN-ranbp1, LMB, leptomycin B, protein transport-antibiotic complex; HET: GNP LMB; 1.78A {Saccharomyces cerevisiae} PDB: 4hau_C* 4hav_C* 4hb2_C* 4hax_C* 4haw_C* 4hay_C* 4hb3_C* 4haz_C* 4hb4_C* 3m1i_C* 4hb0_C* 4gmx_C* 4gpt_C* 3vyc_A 2l1l_B Back     alignment and structure
>1xm9_A Plakophilin 1; armadillo repeat, cell adhesion; 2.80A {Homo sapiens} SCOP: a.118.1.24 Back     alignment and structure
>3l6x_A Catenin delta-1; catenin, armadillo, ARM, JMD, CE adhesion, complex, cell-CELL adhesion, ARVCF, delta-catenin DP120, JAC-1, cell membrane, membrane; 2.40A {Homo sapiens} PDB: 3l6y_A Back     alignment and structure
>3nmz_A APC variant protein; protein-protein complex, armadillo repeats, cell adhesion-CE complex; 3.01A {Homo sapiens} Back     alignment and structure
>3tjz_B Coatomer subunit gamma; protein trafficking, golgi membrane, protein transport-prote binding complex; HET: GNP; 2.90A {Bos taurus} Back     alignment and structure
>3nmw_A APC variant protein; ARMADIILO repeats domain, cell adhesion-cell cycle complex; 1.60A {Homo sapiens} PDB: 3nmx_A 3t7u_A 3au3_A 3qhe_A Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>3b2a_A TON_1937, putative uncharacterized protein; heat-repeats, hypothetical, unknown function; 2.20A {Thermococcus onnurineus} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2of3_A ZYG-9; multifunctional macromolecule, kinetochore, microtubule, XMAP215, STU2, DIS1, microtubule associated protein, structural protein; 1.90A {Caenorhabditis elegans} Back     alignment and structure
>4ffb_C Protein STU2; tubulin fold, heat repeats, cytoskeleton, microtubule, tubul domain, hydrolase; HET: GTP; 2.88A {Saccharomyces cerevisiae} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>4ady_A RPN2, 26S proteasome regulatory subunit RPN2; protein binding, PC repeat; 2.70A {Saccharomyces cerevisiae} PDB: 4b4t_N Back     alignment and structure
>3opb_A SWI5-dependent HO expression protein 4; heat and arm fold, myosin folding and function, myosin bindi protein, protein binding; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3gjx_A Exportin-1; transport, cytoplasm, nucleus, RNA-binding, acetylation, GTP-binding, HOST-virus interaction, nucleotide-binding, phosphoprotein; HET: GTP; 2.50A {Mus musculus} PDB: 3nby_A* 3nbz_A* 3nc0_A* 3nc1_A* 3gb8_A Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3oc3_A Helicase MOT1, MOT1; regulation of transcription, hydrolase-transc complex; HET: MES; 3.10A {Encephalitozoon cuniculi} Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>1te4_A Conserved protein MTH187; methanobacterium thermoautotrophicum, structural proteomics, heat-like repeat; NMR {Methanothermobacterthermautotrophicus} SCOP: a.118.1.16 Back     alignment and structure
>3l9t_A Putative uncharacterized protein SMU.31; hypothetical protein, unknown function; HET: EPE; 2.21A {Streptococcus mutans} Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>3a6p_A Exportin-5; exportin-5, RANGTP, nuclearexport, importin-BE family, nucleus, phosphoprotein, protein transport; HET: GTP; 2.92A {Homo sapiens} Back     alignment and structure
>3tt9_A Plakophilin-2; cell adhesion; 1.55A {Homo sapiens} Back     alignment and structure
>1vsy_4 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_5 Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3grl_A General vesicular transport factor P115; vesicle transport, membrane trafficking, membrane tethering, fusion, snare, RAB GTPase, armadillo repeats; 2.00A {Bos taurus} PDB: 3gq2_A 2w3c_A Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>1vsy_5 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_6 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1vsy_4 Proteasome activator BLM10; 20S proteasome BLM10, hydrolase, nucleus, phosphoprotein, PR proteasome, threonine protease; 3.00A {Saccharomyces cerevisiae} PDB: 3l5q_5 Back     alignment and structure
>3gs3_A Symplekin, LD45768P; helix-turn-helix heat repeat extended loop, transcription, protein binding; 2.40A {Drosophila melanogaster} Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>4gmo_A Putative uncharacterized protein; ARM, heat, solenoid, nuclear transport, chaperone, RPL5, RPL KAP104, nucleus; 2.10A {Chaetomium thermophilum var} PDB: 4gmn_A Back     alignment and structure
>1upk_A MO25 protein; transferase, armadillo; HET: MSE; 1.85A {Homo sapiens} SCOP: a.118.1.15 PDB: 1upl_A 2wtk_A* 3gni_A* Back     alignment and structure
>3fga_B Serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; PP2A, shugoshin, nucleus, phosphoprotein, hydrolase, iron, M metal-binding, methylation, protein phosphatase, cell cycle division; HET: 1ZN; 2.70A {Homo sapiens} PDB: 2iae_B* 2nym_B* 2nyl_B* Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>1w9c_A CRM1 protein, exportin 1; nuclear protein, nuclear export complex; 2.3A {Homo sapiens} SCOP: a.118.1.19 Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>3o2t_A Symplekin; heat repeat, scaffold, protein binding; 1.40A {Homo sapiens} PDB: 3odr_A 3ods_A 4h3k_A* 3o2s_A 3o2q_A* 4h3h_A* Back     alignment and structure
>1lsh_A Lipovitellin (LV-1N, LV-1C); vitellogenin, lipoprotein, plasma apolipoprote apolipoprotein B, APOB; HET: PLD UPL; 1.90A {Ichthyomyzon unicuspis} SCOP: a.118.4.1 f.7.1.1 f.7.1.1 Back     alignment and structure
>1lrv_A LRV, leucine-rich repeat variant; leucine-rich repeats, repetitive structure, iron sulfur proteins, nitrogen fixation; 2.60A {Azotobacter vinelandii} SCOP: a.118.1.5 Back     alignment and structure
>3u0r_A Apoptosis inhibitor 5; heat repeat, armadillo repeat, lysine acetylation; 2.50A {Homo sapiens} PDB: 3v6a_A Back     alignment and structure
>3jxy_A Alkylpurine DNA glycosylase ALKD; heat repeat, DNA binding, DNA glycosylase, DNA alkylation, L complex, hydrolase-DNA complex; HET: DNA; 1.50A {Bacillus cereus} SCOP: a.118.1.0 PDB: 3jx7_A* 3bvs_A 3jy1_A* 3jxz_A* Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>4atg_A TAF6; transcription, TFIID; HET: NHE; 1.89A {Antonospora locustae} Back     alignment and structure
>1ho8_A Vacuolar ATP synthase subunit H; heat repeat, hydrolase; 2.95A {Saccharomyces cerevisiae} SCOP: a.118.1.9 Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>3g2s_A C-terminal fragment of sortilin-related receptor; ADP-ribosylation factor binding protein GGA1, VHS, acidic- cluster dileucine signal, sorla; 1.70A {Homo sapiens} SCOP: a.118.9.2 PDB: 3g2t_A* 3g2u_A 3g2v_A* 3g2w_A 1ujk_A* 1jwf_A 1ujj_A 1jwg_A* 1py1_A* Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>2fv2_A RCD1 required for cell differentiation1 homolog; armadillo-repeat, transcription; 2.20A {Homo sapiens} Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>1juq_A ADP-ribosylation factor binding protein GGA3; protein-peptide compelx, VHS domain, DXXLL sorting signal, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.9.2 PDB: 1jpl_A 1lf8_A* Back     alignment and structure
>2nsz_A Programmed cell death protein 4; PDCD4, tumor suppressor, translation, antitumor protein; 1.15A {Mus musculus} SCOP: a.118.1.14 PDB: 2kzt_B 2hm8_A 2ggf_A Back     alignment and structure
>1mhq_A ADP-ribosylation factor binding protein GGA2; super helix, protein transport; 2.20A {Homo sapiens} SCOP: a.118.9.2 Back     alignment and structure
>2npp_B PP2A, B subunit, serine/threonine-protein phosphatase 2A 56 kDa RE subunit gamma isoform; heat repeat, signaling protein, hydrolase-hydrolase inhibito; HET: 1ZN; 3.30A {Homo sapiens} SCOP: a.118.1.20 Back     alignment and structure
>3ldz_A STAM-1, signal transducing adapter molecule 1; ubiquitin-binding, cytoplasm, UBL conjugation, endosome, membrane, protein transport, SH3 domain; 2.60A {Homo sapiens} SCOP: a.118.9.0 Back     alignment and structure
>1x5b_A Signal transducing adaptor molecule 2; VHS domain, ubiquitin binding, STAM2, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2l0t_B Back     alignment and structure
>1w9c_A CRM1 protein, exportin 1; nuclear protein, nuclear export complex; 2.3A {Homo sapiens} SCOP: a.118.1.19 Back     alignment and structure
>1sz9_A PCF11 protein; RNA polymerase II CTD interacting domain, arm repeats, transcription; 2.10A {Saccharomyces cerevisiae} SCOP: a.118.9.4 PDB: 1sza_A* 2bf0_X Back     alignment and structure
>2b6c_A Hypothetical protein EF3068; structural genomis, DNA repair enzyme, structural genomics, protein structure initiative; HET: SO4; 2.10A {Enterococcus faecalis} SCOP: a.118.1.17 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 438
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 8e-81
d1qbkb_ 888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 1e-06
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 2e-06
d1qbkb_888 a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapi 4e-05
d1qgra_ 876 a.118.1.1 (A:) Importin beta {Human (Homo sapiens) 6e-44
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 3e-43
d1ibrb_458 a.118.1.1 (B:) Importin beta {Human (Homo sapiens) 2e-05
d1wa5c_ 959 a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Sacc 6e-42
d2bpta1 861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 2e-39
d2bpta1861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 8e-05
d2bpta1 861 a.118.1.1 (A:1-861) Importin beta {Baker's yeast ( 2e-04
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 3e-15
d1u6gc_1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-12
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 1e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 9e-06
d1u6gc_ 1207 a.118.1.2 (C:) Cullin-associated NEDD8-dissociated 4e-05
d2vglb_579 a.118.1.10 (B:) Adaptin beta subunit N-terminal fr 2e-05
d1b3ua_588 a.118.1.2 (A:) Constant regulatory domain of prote 4e-05
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin beta2
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  265 bits (676), Expect = 8e-81
 Identities = 188/443 (42%), Positives = 279/443 (62%), Gaps = 21/443 (4%)

Query: 7   WQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVE 66
           W+P EQG  +I +LL++  SP  T  +  + Q+L+Q +Q+PDFNNYL F+L + + +   
Sbjct: 3   WKPDEQGLQQILQLLKESQSPD-TTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEP 61

Query: 67  IRQAAGLLLKNNLRTAYKSMSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGI 126
            R  +GL+LKNN++  +++       +IKSE L  +G +   IR+TVG +++ +   G +
Sbjct: 62  TRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGEL 121

Query: 127 AGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQVLDSDVPGLAECPINIFLPRLL 186
             W +LL  L + LDS D N  EGA  AL KICED  ++LDSD   + + P+NI +P+ L
Sbjct: 122 QNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSD---VLDRPLNIMIPKFL 178

Query: 187 QFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAFN 246
           QFF+     +R  ++  VNQFI+    AL + +D + + LF L+ D   EVRK VC A  
Sbjct: 179 QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFTENLFALAGDEEPEVRKNVCRALV 238

Query: 247 LLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRL 306
           +L+EVR   L PH+ N+ EYMLQ  +D D++VALEACEFW +  E  +  + L   LP+L
Sbjct: 239 MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL 298

Query: 307 VPVLLSNMIYADDDESL--VEAEEDESLPDRDQDLKPRFHSSRLHG------------SE 352
           +PVL++ M Y+D D  L   + EEDE++PD +QD++PRFH SR                +
Sbjct: 299 IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDD 358

Query: 353 NPEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLMPVIQAKLSASGDEAWKDREAA 412
           + E DDDD ++ WNLRKCSAAALDVL+NV+ DE+LP ++P+++  L       W  +E+ 
Sbjct: 359 DDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHILPLLKELLFHHE---WVVKESG 415

Query: 413 VLALGAIAEGCIKGLYPHLSEVI 435
           +L LGAIAEGC++G+ P+L E+I
Sbjct: 416 ILVLGAIAEGCMQGMIPYLPELI 438
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Length = 888 Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 876 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Length = 458 Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 959 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 861 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Length = 1207 Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 588 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
d1qbkb_ 888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 100.0
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 100.0
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 99.97
d1b3ua_ 588 Constant regulatory domain of protein phosphatase 99.82
d1b3ua_588 Constant regulatory domain of protein phosphatase 99.81
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.78
d1qbkb_888 Karyopherin beta2 {Human (Homo sapiens) [TaxId: 96 99.73
d1u6gc_ 1207 Cullin-associated NEDD8-dissociated protein 1 (Tip 99.68
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.61
d2bpta1 861 Importin beta {Baker's yeast (Saccharomyces cerevi 99.6
d1ibrb_458 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.48
d2vglb_ 579 Adaptin beta subunit N-terminal fragment {Human (H 99.47
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.45
d1qgra_ 876 Importin beta {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.39
d1wa5b_503 Karyopherin alpha {Baker's yeast (Saccharomyces ce 99.23
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 99.21
d1q1sc_434 Importin alpha {Mouse (Mus musculus) [TaxId: 10090 99.18
d1jdha_529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.85
d1jdha_ 529 beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1oyza_276 Hypothetical protein YibA {Escherichia coli [TaxId 98.84
d2vgla_ 584 Adaptin alpha C subunit N-terminal fragment {Mouse 98.66
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.55
d1wa5c_ 959 Exportin Cse1p {Baker's yeast (Saccharomyces cerev 98.49
d1xqra1264 Hsp70-binding protein 1 (HspBP1) {Human (Homo sapi 98.46
d1xm9a1457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 98.34
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 98.12
d1te4a_111 MTH187 {Archaeon Methanobacterium thermoautotrophi 97.91
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1xm9a1 457 Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} 97.41
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.38
d1lsha1336 Lipovitellin-phosvitin complex, superhelical domai 96.05
d1upka_330 Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} 95.81
d1w9ca_321 Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [Tax 94.13
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 93.34
d2jaka1343 Serine/threonine-protein phosphatase 2A regulatory 91.62
d1ho8a_477 Regulatory subunit H of the V-type ATPase {Baker's 91.57
d1w9ca_321 Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [Tax 91.21
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 90.35
d1lrva_233 Leucine-rich repeat variant {Azotobacter vinelandi 89.09
d1ujka_145 ADP-ribosylation factor binding protein Gga1 {Huma 86.19
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 85.59
d2b6ca1213 Hypothetical protein EF3068 {Enterococcus faecalis 85.36
d1dvpa1145 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 83.45
d2nsza1129 Programmed cell death 4, PDCD4 {Mouse (Mus musculu 82.21
d1mhqa_143 ADP-ribosylation factor binding protein Gga2 {Huma 81.3
d1juqa_151 ADP-ribosylation factor binding protein Gga3 {Huma 81.07
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: ARM repeat
family: Armadillo repeat
domain: Karyopherin beta2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.9e-49  Score=418.49  Aligned_cols=424  Identities=44%  Similarity=0.807  Sum_probs=364.3

Q ss_pred             CCCCCHHHHHHHHHHHHhhcCCCCHHHHHHHHHHHHHhhcCCcHHHHHHHHHhhccCCCHHHHHHHHHHHHHHHHhhhcc
Q 013663            6 AWQPQEQGFNEICRLLEQQISPSSTADKSQIWQQLQQYSQFPDFNNYLAFILARAEGKSVEIRQAAGLLLKNNLRTAYKS   85 (438)
Q Consensus         6 ~~~~~~~~~~~l~~~l~~~~s~d~~~~r~~A~~~L~~~~~~p~~~~~l~~il~~~~~~~~~~R~~A~~~Lk~~i~~~w~~   85 (438)
                      .|+|+++++++|.++|+.++|||++ +|++|+++|++++++|++..+|..++.+..+.+..+|++|+++|||.+.++|..
T Consensus         2 ~~~p~~~~l~ql~~~L~~~~s~d~~-~r~~A~~~L~~~~~~p~~~~~L~~ll~~~~~~~~~~R~~A~i~Lkn~i~~~w~~   80 (888)
T d1qbkb_           2 EWKPDEQGLQQILQLLKESQSPDTT-IQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSEDEPTRSLSGLILKNNVKAHFQN   80 (888)
T ss_dssp             CSHHHHTTHHHHHHHHTTCCHHHHH-HHHHHTTSTTTSTTSTTTTTCTTSSSTTTSCSTTTHHHHTTGGGGGTHHHHTTC
T ss_pred             CCCCChHHHHHHHHHHHHhcCCCHH-HHHHHHHHHHHHHhCCCHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhhcc
Confidence            6999999999999999999999999 999999999999999999988888887544667889999999999999999999


Q ss_pred             CCHhhHHHHHHHhhhhhhcCcHHHHHHHHHHHHHHHHhhccCchHHHHHHHHHHhccCChhhHhHHHHHHHHHHhccccc
Q 013663           86 MSPSNQQYIKSELLPCLGAADRHIRSTVGTIVSVVVQLGGIAGWLELLQALVTCLDSNDINHMEGAMDALSKICEDIPQV  165 (438)
Q Consensus        86 l~~~~~~~i~~~ll~~l~~~~~~vr~~~a~~la~i~~~~~~~~w~~ll~~l~~~l~~~~~~~r~~al~~l~~l~~~~~~~  165 (438)
                      ++++.++.||+.+++.|.++++.||+.++.+++.|++.++++.||+++|.|.+.+.++++.++++|+.+|+.+|++....
T Consensus        81 ~~~~~~~~Ik~~ll~~l~~~~~~vr~~~~~~i~~i~~~~~~~~Wpell~~L~~~l~s~~~~~~~~al~~L~~i~e~~~~~  160 (888)
T d1qbkb_          81 FPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASKGELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEI  160 (888)
T ss_dssp             STTTCCHHHHHHHTTGGGCCCSSTTTTTTTTTHHHHTTTSSCSSTTTSTTTTTSSTGGGSSCSSSSSTTTHHHHGGGHHH
T ss_pred             CCHHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHhCccchHHHHHHHHHHhCCCCHHHHHHHHHHHHHHHHHhHHH
Confidence            99999999999999999999999999999999999998888999999999999999888899999999999999988765


Q ss_pred             cccCCCCCCcchhhhHHHHHHHhccCCCHHHHHHHHHHHHHHHcccchhhHHhHHHHHHHHHHhhCCCCHHHHHHHHHHH
Q 013663          166 LDSDVPGLAECPINIFLPRLLQFFQSPHTSLRKLSLGSVNQFIMLMPSALFVSMDQYLQGLFLLSNDPSAEVRKLVCAAF  245 (438)
Q Consensus       166 ~~~~~~~~~~~~~~~il~~l~~~l~~~~~~vr~~al~~l~~~~~~~~~~~~~~~~~ll~~l~~~~~~~~~~~~~~a~~~l  245 (438)
                      +.++   ......+.++|.++++++++++.+|..|+++++.++...+..+..+++.+++.++....++++++|..+++++
T Consensus       161 ~~~~---~~~~~~~~ll~~ll~~~~~~~~~vr~~al~~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~~~~~vr~~~~~~l  237 (888)
T d1qbkb_         161 LDSD---VLDRPLNIMIPKFLQFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFTENLFALAGDEEPEVRKNVCRAL  237 (888)
T ss_dssp             HHTC------CCSTTTTHHHHTGGGSSSSCSSSTTTHHHHGGGGCCCSTTCSHHHHCSHHHHTTSSCCCSSSTTHHHHTT
T ss_pred             hhHH---HHHHHHHHHHHHHHHHhhCCCHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHhcCCcchHHHHHHHHHH
Confidence            5432   2234567899999999999999999999999999888777666667788889999988888999999999999


Q ss_pred             HHHHhhCcccccccHHHHHHHHhhhhcCCChHHHhHHHHHHHHhhccCCChhhHHhhHHHHHHHHHhccCcChhhhhhc-
Q 013663          246 NLLIEVRPSFLEPHLRNLFEYMLQVNKDTDDDVALEACEFWHSYFEAQLPHENLKEFLPRLVPVLLSNMIYADDDESLV-  324 (438)
Q Consensus       246 ~~l~~~~~~~~~~~~~~li~~~~~~~~~~~~~v~~~a~~~~~~~~~~~~~~~~~~~~l~~l~~~l~~~l~~~~~d~~~~-  324 (438)
                      ..+++.+++.+.||++.++++++..+++.+++++..|++||.++++.+.....+.++++.++|.++..+...+.+.... 
T Consensus       238 ~~l~~~~~~~l~~~l~~i~~~~l~~~~~~~e~v~~~a~ef~~~~~e~~~~~~~~~~~l~~l~~~l~~~~~~~~~~~~~~~  317 (888)
T d1qbkb_         238 VMLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKLIPVLVNGMKYSDIDIILLK  317 (888)
T ss_dssp             TTTSCSCTTTTTTTTTTTTTTTTTTTTSSCHHHHHHHHHHHCCCCSGGGGTTTTTTSTTTTTTTTTTSSCCSSTTHHHHT
T ss_pred             HHHHHHhHHHHHHHHHHHHHHHHHhcCCCcHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHhhcchHHHHHHh
Confidence            9999999999999999999999999999999999999999999998754556677889999999988887766554322 


Q ss_pred             -cccccCCCCCCCCCCCCccccCCCCCCC-------C-----CCCCccccccchhhhhhHHHHHHHHHhhhchhhHHhHH
Q 013663          325 -EAEEDESLPDRDQDLKPRFHSSRLHGSE-------N-----PEDDDDDIVNVWNLRKCSAAALDVLSNVFGDEILPTLM  391 (438)
Q Consensus       325 -~~~~~~~~~d~~~~i~~~~~~~~~~~~~-------~-----~~~~d~~~~~~~~~r~~a~~~l~~l~~~~~~~~~~~l~  391 (438)
                       +.+++...++...+++|.++........       .     .+.++++....|++|++|..+|+.++..+|+.+++.++
T Consensus       318 ~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~a~~~L~~l~~~~~~~il~~~l  397 (888)
T d1qbkb_         318 GDVEEDETIPDSEQDIRPRFHRSRTVAQQHDEDGIEEEDDDDDEIDDDDTISDWNLRKCSAAALDVLANVYRDELLPHIL  397 (888)
T ss_dssp             TTSSCCTTSCCCGGGCCCCCCCCCCCCCCCTTC-----CHHHHTTCCCSTTSCCSSHHHHHHHSTTTTTTCCSSSHHHHH
T ss_pred             hhhhhhhhhhhhHHHHHHHHHHHHHHHHHhhhhhhhhcccchhhhhhhhhhhhhhHHHHHHHHHhhHhhhhHHHHHHHHH
Confidence             2234455667777888876653321110       0     01122223457899999999999999999999999999


Q ss_pred             HHHHHHhccCCCCcchhhHHHHHHHHHHhhcchhhhhhccccccc
Q 013663          392 PVIQAKLSASGDEAWKDREAAVLALGAIAEGCIKGLYPHLSEVIF  436 (438)
Q Consensus       392 ~~l~~~l~~~~~~~w~~r~aal~~l~~l~~~~~~~~~~~l~~i~~  436 (438)
                      |++.+.+++++   |+.|+||+++||++++||.+.+.++++++++
T Consensus       398 ~~l~~~l~s~~---~~~reaa~~alg~i~eg~~~~~~~~l~~li~  439 (888)
T d1qbkb_         398 PLLKELLFHHE---WVVKESGILVLGAIAEGCMQGMIPYLPELIP  439 (888)
T ss_dssp             HHHHHTTTSSS---HHHHHHHHHHHHHHTTTSHHHHTTTHHHHHH
T ss_pred             HHHHHhhccch---hHHHHHHHHHhhhhhhhHHHHhcccchhhhH
Confidence            99999999998   9999999999999999999999999988764
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b3ua_ a.118.1.2 (A:) Constant regulatory domain of protein phosphatase 2a, pr65alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbkb_ a.118.1.1 (B:) Karyopherin beta2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6gc_ a.118.1.2 (C:) Cullin-associated NEDD8-dissociated protein 1 (Tip120) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bpta1 a.118.1.1 (A:1-861) Importin beta {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ibrb_ a.118.1.1 (B:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qgra_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wa5b_ a.118.1.1 (B:) Karyopherin alpha {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1sc_ a.118.1.1 (C:) Importin alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jdha_ a.118.1.1 (A:) beta-Catenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyza_ a.118.1.16 (A:) Hypothetical protein YibA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wa5c_ a.118.1.1 (C:) Exportin Cse1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xqra1 a.118.1.21 (A:87-350) Hsp70-binding protein 1 (HspBP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1te4a_ a.118.1.16 (A:) MTH187 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xm9a1 a.118.1.24 (A:244-700) Plakophilin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1lsha1 a.118.4.1 (A:285-620) Lipovitellin-phosvitin complex, superhelical domain {Lamprey (Ichthyomyzon unicuspis) [TaxId: 30308]} Back     information, alignment and structure
>d1upka_ a.118.1.15 (A:) Mo25 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ca_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2jaka1 a.118.1.20 (A:30-372) Serine/threonine-protein phosphatase 2A regulatory subunit B56-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ho8a_ a.118.1.9 (A:) Regulatory subunit H of the V-type ATPase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w9ca_ a.118.1.19 (A:) Exportin-1 (Xpo1, Crm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1lrva_ a.118.1.5 (A:) Leucine-rich repeat variant {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ujka_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6ca1 a.118.1.17 (A:3-215) Hypothetical protein EF3068 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1dvpa1 a.118.9.2 (A:1-145) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2nsza1 a.118.1.14 (A:322-450) Programmed cell death 4, PDCD4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mhqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juqa_ a.118.9.2 (A:) ADP-ribosylation factor binding protein Gga3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure