Citrus Sinensis ID: 013667

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENEGRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL
ccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccHHcccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEccccccEEEEEEEc
cccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcHHHHHHHHccHHHHcccccccccccccccccccccccHcccccccccccccccccccccccccccccccccccEEEEEcccccccHHHHHHHHHHcccEEEEEEEEcccccEEEEEEEc
MCNARAHLEEQisrqdlsdsEKFQQYMIYLKYeqssgdpgrVQLLYERaitdfpvssdlWLDYTQYLDKTLKVGNVVRDVYSratkncpwvgELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCyskrftgtgseDICHAWLRFEreygtledfdhsvqKVTPRLEELRLFRsqqeskslpesadqkEHSVKKtgrekrksdsnisyeqspakrqkhapqkpkkvhdkEKRQVQNLAeenegretkqtveeqpkkqpikdavpgrtkgftDECTAFLSNINLKATYEDLRRFFsdvggvssirilhdkftgksrvsffl
mcnarahleeqisrqdlsdsEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYsratkncpwvgeLWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKrftgtgseDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSqqeskslpesadqkehsvkktgrekrksdsnisyeqspakrqkhapqkpkkvhdkekrqvqnlaeenegretkqtveeqpkkqpikdavpgrtkGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSsirilhdkftgksrvsffl
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVrsllslersraseeeISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENEGRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL
**********************FQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLER******EISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKV**********************************************************************************************************GFTDECTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTG********
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPES*****************************************************************************************CTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL
****************LSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFR**************************************************************************************KDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLP*****************************************************************************************DECTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVxxxxxxxxxxxxxxxxxxxxxQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query438 2.2.26 [Sep-21-2011]
Q15020 963 Squamous cell carcinoma a yes no 0.947 0.430 0.278 3e-40
Q5REG1 981 Squamous cell carcinoma a yes no 0.947 0.423 0.278 3e-40
Q9JLI8 962 Squamous cell carcinoma a yes no 0.933 0.425 0.279 2e-38
Q9USY2 1014 Uncharacterized RNA-bindi yes no 0.363 0.156 0.287 7e-09
Q4PB37 781 Pre-mRNA-splicing factor N/A no 0.543 0.304 0.257 2e-08
Q146901871 Protein RRP5 homolog OS=H no no 0.522 0.122 0.255 1e-05
P63155690 Crooked neck-like protein no no 0.497 0.315 0.255 2e-05
P63154690 Crooked neck-like protein no no 0.497 0.315 0.255 2e-05
Q6NS461862 Protein RRP5 homolog OS=M no no 0.522 0.122 0.240 2e-05
Q9BZJ0848 Crooked neck-like protein no no 0.495 0.255 0.249 5e-05
>sp|Q15020|SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens GN=SART3 PE=1 SV=1 Back     alignment and function desciption
 Score =  166 bits (421), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/453 (27%), Positives = 212/453 (46%), Gaps = 38/453 (8%)

Query: 18  SDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVV 77
           +++ +  +Y  Y+ +E   GDP R+QL++ERA+ +  +  DLW+ Y+QYLD+ LKV ++V
Sbjct: 305 AEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKVKDLV 364

Query: 78  RDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTR 137
             V++RA +NCPW   LW R LL++ER     + IS  FEK+L   F    +Y++++   
Sbjct: 365 LSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAY 424

Query: 138 IDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQM-----KNTDGLLRLYAYWAHLE 192
           +D LRRR+ F  +    L+   +R  F RA +YL +++     ++ D    +   WA +E
Sbjct: 425 LDYLRRRVDFKQDSSKELEE--LRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE 482

Query: 193 QSMGKDMVSARGVWERLLKISGA-MLEAWQSYISMEIELDHINEARSIYKRCYSKRFTGT 251
             +  +M  AR +W+ ++    A     W  Y ++E         R    R    + T  
Sbjct: 483 ARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAV--QCTSD 540

Query: 252 GSEDICHAWLRFEREYGTLEDFDHSVQKVTPRL---EELRLFRSQQESKSL---PESADQ 305
             E +C   L  ER  G+LED+D +VQK   RL    E R+  +++E+  +    E A+Q
Sbjct: 541 YPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQ 600

Query: 306 KEHSVKKT----------GREKRKSDSNISY------EQSPAKRQKHAPQKPKKVHDKEK 349
           ++ +  +           G EKR +D +         E+ P+KR++     P     +  
Sbjct: 601 RKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNV 660

Query: 350 RQVQNLAEENEGRETKQTVEEQPKKQPIKDAVPGRTKGFT-DECTAFLSNINLKATYED- 407
                 A +    + +   +++ K   +K  +P      + D  T F+SN+       D 
Sbjct: 661 EVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDT 720

Query: 408 -LRRFFSDVGGVSSIRILHDK---FTGKSRVSF 436
            LR  F   G V  IR +      F G   V F
Sbjct: 721 KLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEF 753
Regulates Tat transactivation activity through direct interaction. May be a cellular factor for HIV-1 gene expression and viral replication.
Homo sapiens (taxid: 9606)
>sp|Q5REG1|SART3_PONAB Squamous cell carcinoma antigen recognized by T-cells 3 OS=Pongo abelii GN=SART3 PE=2 SV=1 Back     alignment and function description
>sp|Q9JLI8|SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus GN=Sart3 PE=2 SV=1 Back     alignment and function description
>sp|Q9USY2|YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1861.04c PE=4 SV=1 Back     alignment and function description
>sp|Q4PB37|CLF1_USTMA Pre-mRNA-splicing factor CLF1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLF1 PE=3 SV=1 Back     alignment and function description
>sp|Q14690|RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 Back     alignment and function description
>sp|P63155|CRNL1_RAT Crooked neck-like protein 1 OS=Rattus norvegicus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|P63154|CRNL1_MOUSE Crooked neck-like protein 1 OS=Mus musculus GN=Crnkl1 PE=2 SV=1 Back     alignment and function description
>sp|Q6NS46|RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus GN=Pdcd11 PE=2 SV=2 Back     alignment and function description
>sp|Q9BZJ0|CRNL1_HUMAN Crooked neck-like protein 1 OS=Homo sapiens GN=CRNKL1 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
255573806 852 Squamous cell carcinoma antigen recogniz 0.979 0.503 0.711 1e-179
359486200 838 PREDICTED: squamous cell carcinoma antig 0.979 0.511 0.669 1e-164
297739447 819 unnamed protein product [Vitis vinifera] 0.979 0.523 0.669 1e-164
356541840 837 PREDICTED: squamous cell carcinoma antig 0.965 0.505 0.628 1e-158
449450119 800 PREDICTED: squamous cell carcinoma antig 0.968 0.53 0.618 1e-158
356560763 847 PREDICTED: squamous cell carcinoma antig 0.965 0.499 0.619 1e-155
224129810 843 predicted protein [Populus trichocarpa] 0.933 0.485 0.626 1e-151
297799572 820 RNA recognition motif-containing protein 0.956 0.510 0.588 1e-143
30686466 817 protein embryo defective 140 [Arabidopsi 0.961 0.515 0.593 1e-143
30686462 816 protein embryo defective 140 [Arabidopsi 0.961 0.515 0.593 1e-143
>gi|255573806|ref|XP_002527822.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] gi|223532746|gb|EEF34525.1| Squamous cell carcinoma antigen recognized by T-cells, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  633 bits (1632), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 308/433 (71%), Positives = 362/433 (83%), Gaps = 4/433 (0%)

Query: 1   MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLW 60
           M N RA  EEQI +QD+S+ EKFQ +M YL +E+++GDP RVQ+LYERAIT+FPVSSD+W
Sbjct: 289 MYNTRAQHEEQIYKQDISEQEKFQNFMNYLNFEKTAGDPARVQVLYERAITEFPVSSDIW 348

Query: 61  LDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFEKSL 120
           LDYT YLDKTLKVGN+V+D Y RAT+NC WVGELWVR LLSLERSRA E+EISTVFE+SL
Sbjct: 349 LDYTCYLDKTLKVGNIVKDAYFRATRNCSWVGELWVRYLLSLERSRAHEKEISTVFEESL 408

Query: 121 LCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDG 180
            C FST EEYLDLFLTR+DGLRRRILF  E EGVL+YSLI+ET Q ASDYLS Q+KNT+G
Sbjct: 409 QCLFSTAEEYLDLFLTRVDGLRRRILFGSEAEGVLNYSLIKETMQHASDYLSPQLKNTEG 468

Query: 181 LLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIY 240
           LLRL+AYWA LE ++GKD+V+ARGVWE LLKISG+MLE WQ YI+ME EL HINEARSIY
Sbjct: 469 LLRLHAYWARLELNLGKDLVAARGVWESLLKISGSMLEVWQGYITMETELGHINEARSIY 528

Query: 241 KRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLP 300
           KRCYSKRFTGTGSEDICH+WLRFERE+G LEDFDH+VQKVTPRLEEL+L+R QQESK+  
Sbjct: 529 KRCYSKRFTGTGSEDICHSWLRFEREFGALEDFDHAVQKVTPRLEELQLYRMQQESKAFV 588

Query: 301 ESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENE 360
            SADQKE+ +K+  REKRK     + EQSPAKR+K  PQ  +K ++K K Q QNLAE  +
Sbjct: 589 ASADQKENPIKRNVREKRKGGPEYTDEQSPAKRKKQTPQ-TQKGYEKSKDQPQNLAEVTK 647

Query: 361 GRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSS 420
            +  ++T  +Q K+Q  KD   GR KG+TD+CTAFLSN++LKA YEDLR+FFSDVGGV S
Sbjct: 648 PK-VEKTDSKQEKQQ--KDYDSGRNKGYTDQCTAFLSNLHLKANYEDLRKFFSDVGGVVS 704

Query: 421 IRILHDKFTGKSR 433
           IRIL DK+TGKSR
Sbjct: 705 IRILLDKYTGKSR 717

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|359486200|ref|XP_002268805.2| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297739447|emb|CBI29629.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356541840|ref|XP_003539380.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Glycine max] Back     alignment and taxonomy information
>gi|449450119|ref|XP_004142811.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356560763|ref|XP_003548657.1| PREDICTED: squamous cell carcinoma antigen recognized by T-cells 3-like [Glycine max] Back     alignment and taxonomy information
>gi|224129810|ref|XP_002328808.1| predicted protein [Populus trichocarpa] gi|222839106|gb|EEE77457.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297799572|ref|XP_002867670.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297313506|gb|EFH43929.1| RNA recognition motif-containing protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|30686466|ref|NP_194158.3| protein embryo defective 140 [Arabidopsis thaliana] gi|332659482|gb|AEE84882.1| protein embryo defective 140 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|30686462|ref|NP_849551.1| protein embryo defective 140 [Arabidopsis thaliana] gi|332659481|gb|AEE84881.1| protein embryo defective 140 [Arabidopsis thaliana] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query438
TAIR|locus:2135892 817 EMB140 "EMBRYO DEFECTIVE 140" 0.961 0.515 0.572 6.8e-127
UNIPROTKB|E1BWJ0731 SART3 "Uncharacterized protein 0.929 0.556 0.290 3.3e-43
ZFIN|ZDB-GENE-040724-10 952 sart3 "squamous cell carcinoma 0.753 0.346 0.301 1.7e-41
UNIPROTKB|F1N0I9 655 SART3 "Uncharacterized protein 0.867 0.580 0.265 1.3e-39
UNIPROTKB|F1RGA7 959 SART3 "Uncharacterized protein 0.751 0.343 0.298 3.5e-39
UNIPROTKB|E2QXZ2 1082 SART3 "Uncharacterized protein 0.767 0.310 0.290 5.8e-39
MGI|MGI:1858230 962 Sart3 "squamous cell carcinoma 0.831 0.378 0.272 4.1e-38
UNIPROTKB|Q15020 963 SART3 "Squamous cell carcinoma 0.767 0.348 0.282 1.4e-37
RGD|1311646 960 Sart3 "squamous cell carcinoma 0.817 0.372 0.280 5.2e-37
UNIPROTKB|F8VV04771 SART3 "Squamous cell carcinoma 0.767 0.435 0.282 2.7e-36
TAIR|locus:2135892 EMB140 "EMBRYO DEFECTIVE 140" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1246 (443.7 bits), Expect = 6.8e-127, P = 6.8e-127
 Identities = 248/433 (57%), Positives = 311/433 (71%)

Query:     1 MCNARAHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLW 60
             M + RAHLEE IS+QDLSD+EKFQ++M Y+K+E++SGDP RVQ +YERA+ ++PVSSDLW
Sbjct:   272 MYSERAHLEENISKQDLSDTEKFQEFMNYIKFEKTSGDPTRVQAIYERAVAEYPVSSDLW 331

Query:    61 LDYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVXXXXXXXXXXXXXXXISTVFEKSL 120
             +DYT YLDKTLKVG  +   YSRAT++CPW G+LW                I  VFEKSL
Sbjct:   332 IDYTVYLDKTLKVGKAITHAYSRATRSCPWTGDLWARYLLALERGSASEKEIYDVFEKSL 391

Query:   121 LCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKNTDG 180
              C FS+FEEYLDL+LTR+DGLRRR+L +  +E  LDYSLIRETFQ+ASDYL+  M+NTD 
Sbjct:   392 QCTFSSFEEYLDLYLTRVDGLRRRMLSTRMLEA-LDYSLIRETFQQASDYLTPHMQNTDS 450

Query:   181 LLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEARSIY 240
             LL L+ YWA+LE ++GKD+  ARGVW+  LK SG ML AW +YI ME+ L HI EARSIY
Sbjct:   451 LLHLHTYWANLELNIGKDLAGARGVWDSFLKKSGGMLAAWHAYIDMEVHLGHIKEARSIY 510

Query:   241 KRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLP 300
             +RCY+++F GTGSEDIC  WLRFERE+G LE FD +VQKV PRLEEL+L R QQES  + 
Sbjct:   511 RRCYTRKFDGTGSEDICKGWLRFEREHGDLEHFDLAVQKVMPRLEELQLMRLQQESTPVK 570

Query:   301 ESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQNLAEENE 360
              SA  KEHS      +KRK++ N+  E+S AKRQK   QK  +V D   +     A +N 
Sbjct:   571 PSAGLKEHS-----SQKRKAEQNVE-EESLAKRQKRKSQK--EV-DLGGQSATVPATKNV 621

Query:   361 GRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSDVGGVSS 420
               E  +T +    K+  +DA P + K + DECTAF+SN+++KA  ED+R+FF D GGV S
Sbjct:   622 KAENGKTADSD--KEETEDAKPLKPKVYRDECTAFISNLSVKAQEEDIRKFFGDDGGVDS 679

Query:   421 IRILHDKFTGKSR 433
             IRILH K TGK R
Sbjct:   680 IRILHHKDTGKPR 692
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006396 "RNA processing" evidence=IEA
GO:0009793 "embryo development ending in seed dormancy" evidence=NAS
GO:0009560 "embryo sac egg cell differentiation" evidence=RCA
UNIPROTKB|E1BWJ0 SART3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040724-10 sart3 "squamous cell carcinoma antigen recognised by T cells 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0I9 SART3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGA7 SART3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXZ2 SART3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1858230 Sart3 "squamous cell carcinoma antigen recognized by T cells 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q15020 SART3 "Squamous cell carcinoma antigen recognized by T-cells 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311646 Sart3 "squamous cell carcinoma antigen recognized by T-cells 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F8VV04 SART3 "Squamous cell carcinoma antigen recognized by T-cells 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-09
smart0036073 smart00360, RRM, RNA recognition motif 2e-07
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-07
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-06
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 3e-05
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 4e-05
pfam0007670 pfam00076, RRM_1, RNA recognition motif 6e-05
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 9e-05
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 1e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-04
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-04
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 4e-04
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 6e-04
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 0.001
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 0.002
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.002
smart0038633 smart00386, HAT, HAT (Half-A-TPR) repeats 0.003
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 0.003
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.003
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 0.003
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 0.004
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information 
 Score = 56.1 bits (134), Expect = 9e-09
 Identities = 30/139 (21%), Positives = 56/139 (40%), Gaps = 3/139 (2%)

Query: 295 ESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVHDKEKRQVQN 354
           ES  L E   ++E+   +    K  +    S +           +K     ++++   + 
Sbjct: 22  ESGKLTELLLKEEYGGLEEANSKELNLEVNSRKIESEISPP--SKKRLLSSERKEENERE 79

Query: 355 LAEENEGRETKQTVEEQPKKQPIKDAVPGRTKGFTDECTAFLSNINLKATYEDLRRFFSD 414
           + E+N+G        E+   +  +     +     +  T F+ N+    T EDLR  F  
Sbjct: 80  MEEQNDGERGYTKEFEEELFRSSESPKSRQKS-KEENNTLFVGNLPYDVTEEDLRELFKK 138

Query: 415 VGGVSSIRILHDKFTGKSR 433
            G V  +R++ D+ TGKSR
Sbjct: 139 FGPVKRVRLVRDRETGKSR 157

Length = 306
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|214642 smart00386, HAT, HAT (Half-A-TPR) repeats Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 438
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 100.0
KOG1915 677 consensus Cell cycle control protein (crooked neck 100.0
KOG1915677 consensus Cell cycle control protein (crooked neck 99.97
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.9
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.89
KOG1914656 consensus mRNA cleavage and polyadenylation factor 99.88
KOG2047835 consensus mRNA splicing factor [RNA processing and 99.87
KOG1258577 consensus mRNA processing protein [RNA processing 99.87
KOG2047 835 consensus mRNA splicing factor [RNA processing and 99.83
KOG0495913 consensus HAT repeat protein [RNA processing and m 99.77
KOG10701710 consensus rRNA processing protein Rrp5 [RNA proces 99.77
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.69
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.66
COG5107660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.63
KOG2396568 consensus HAT (Half-A-TPR) repeat-containing prote 99.61
KOG1258577 consensus mRNA processing protein [RNA processing 99.6
COG5107 660 RNA14 Pre-mRNA 3'-end processing (cleavage and pol 99.59
KOG1914 656 consensus mRNA cleavage and polyadenylation factor 99.55
PF05843280 Suf: Suppressor of forked protein (Suf); InterPro: 99.53
KOG0128 881 consensus RNA-binding protein SART3 (RRM superfami 99.37
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.36
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.32
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.28
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.26
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.24
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.22
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.18
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.18
KOG4626 966 consensus O-linked N-acetylglucosamine transferase 99.16
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.15
PRK11788389 tetratricopeptide repeat protein; Provisional 99.13
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.09
KOG0126 219 consensus Predicted RNA-binding protein (RRM super 99.09
PRK11189296 lipoprotein NlpI; Provisional 99.08
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.05
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.04
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 99.03
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.02
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.0
PRK11788389 tetratricopeptide repeat protein; Provisional 98.98
PRK12370553 invasion protein regulator; Provisional 98.98
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 98.98
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.98
KOG0122270 consensus Translation initiation factor 3, subunit 98.93
KOG0113 335 consensus U1 small nuclear ribonucleoprotein (RRM 98.9
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.89
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 98.88
PRK11189296 lipoprotein NlpI; Provisional 98.88
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.88
PRK09782987 bacteriophage N4 receptor, outer membrane subunit; 98.87
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.87
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.8
PRK12370553 invasion protein regulator; Provisional 98.8
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.77
KOG0125 376 consensus Ataxin 2-binding protein (RRM superfamil 98.77
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.74
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.74
PF08424321 NRDE-2: NRDE-2, necessary for RNA interference; In 98.73
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 98.7
KOG1125579 consensus TPR repeat-containing protein [General f 98.7
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 98.69
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 98.68
PLN02789320 farnesyltranstransferase 98.66
KOG0547606 consensus Translocase of outer mitochondrial membr 98.65
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.65
KOG2076 895 consensus RNA polymerase III transcription factor 98.64
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.63
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.63
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.61
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 98.6
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.59
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 98.59
KOG2076 895 consensus RNA polymerase III transcription factor 98.59
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.56
KOG1129478 consensus TPR repeat-containing protein [General f 98.56
PLN03218 1060 maturation of RBCL 1; Provisional 98.53
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.52
KOG0547606 consensus Translocase of outer mitochondrial membr 98.52
KOG1155559 consensus Anaphase-promoting complex (APC), Cdc23 98.5
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.5
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 98.49
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.49
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.48
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.47
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.46
PLN03218 1060 maturation of RBCL 1; Provisional 98.46
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 98.46
KOG0145 360 consensus RNA-binding protein ELAV/HU (RRM superfa 98.46
COG0724 306 RNA-binding proteins (RRM domain) [General functio 98.44
KOG20021018 consensus TPR-containing nuclear phosphoprotein th 98.43
KOG0148 321 consensus Apoptosis-promoting RNA-binding protein 98.42
PRK10370198 formate-dependent nitrite reductase complex subuni 98.42
PLN02789320 farnesyltranstransferase 98.42
KOG4207 256 consensus Predicted splicing factor, SR protein su 98.41
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 98.41
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 98.41
KOG1125579 consensus TPR repeat-containing protein [General f 98.39
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 98.39
COG5191435 Uncharacterized conserved protein, contains HAT (H 98.37
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 98.36
smart0036272 RRM_2 RNA recognition motif. 98.34
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.3
PRK14574 822 hmsH outer membrane protein; Provisional 98.3
KOG1126638 consensus DNA-binding cell division cycle control 98.29
PRK10370198 formate-dependent nitrite reductase complex subuni 98.28
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 98.26
PRK15359144 type III secretion system chaperone protein SscB; 98.26
smart0036071 RRM RNA recognition motif. 98.24
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 98.2
KOG1126638 consensus DNA-binding cell division cycle control 98.2
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 98.18
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.15
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.15
KOG3060289 consensus Uncharacterized conserved protein [Funct 98.15
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 98.14
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.12
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.12
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 98.11
KOG0114124 consensus Predicted RNA-binding protein (RRM super 98.09
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 98.06
PLN03077857 Protein ECB2; Provisional 98.06
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 98.04
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 98.04
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 98.03
PF08311126 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro 97.99
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 97.98
PRK15359144 type III secretion system chaperone protein SscB; 97.98
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.97
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.96
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.95
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.94
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 97.94
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.93
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 97.91
PLN03077857 Protein ECB2; Provisional 97.91
PRK14574 822 hmsH outer membrane protein; Provisional 97.91
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 97.9
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 97.87
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.86
KOG2002 1018 consensus TPR-containing nuclear phosphoprotein th 97.86
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.81
KOG4205 311 consensus RNA-binding protein musashi/mRNA cleavag 97.8
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.79
KOG1173611 consensus Anaphase-promoting complex (APC), Cdc16 97.72
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 97.7
KOG4208 214 consensus Nucleolar RNA-binding protein NIFK [Gene 97.67
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.65
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.64
PRK14720 906 transcript cleavage factor/unknown domain fusion p 97.62
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 97.6
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.59
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 97.58
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.57
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.57
TIGR02552135 LcrH_SycD type III secretion low calcium response 97.56
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 97.56
KOG2003840 consensus TPR repeat-containing protein [General f 97.55
KOG1156 700 consensus N-terminal acetyltransferase [Chromatin 97.5
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 97.48
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 97.48
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 97.47
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 97.43
cd05804355 StaR_like StaR_like; a well-conserved protein foun 97.43
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 97.42
PRK10153517 DNA-binding transcriptional activator CadC; Provis 97.41
KOG1840508 consensus Kinesin light chain [Cytoskeleton] 97.41
PF1342844 TPR_14: Tetratricopeptide repeat 97.41
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.4
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 97.38
smart0036170 RRM_1 RNA recognition motif. 97.38
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 97.38
KOG0226290 consensus RNA-binding proteins [General function p 97.36
KOG1128777 consensus Uncharacterized conserved protein, conta 97.34
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.34
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.33
PF0218432 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 97.3
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.28
smart00777125 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 97.27
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 97.24
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 97.24
KOG1128777 consensus Uncharacterized conserved protein, conta 97.22
PF12569517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.22
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.21
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 97.19
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.19
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.18
KOG0123369 consensus Polyadenylate-binding protein (RRM super 97.17
PF1342844 TPR_14: Tetratricopeptide repeat 97.16
KOG2003840 consensus TPR repeat-containing protein [General f 97.16
KOG1174564 consensus Anaphase-promoting complex (APC), subuni 97.15
KOG0153 377 consensus Predicted RNA-binding protein (RRM super 97.12
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.11
KOG1548 382 consensus Transcription elongation factor TAT-SF1 97.1
KOG0415 479 consensus Predicted peptidyl prolyl cis-trans isom 97.09
KOG4162799 consensus Predicted calmodulin-binding protein [Si 97.05
cd00189100 TPR Tetratricopeptide repeat domain; typically con 96.99
KOG0533 243 consensus RRM motif-containing protein [RNA proces 96.95
PRK02603172 photosystem I assembly protein Ycf3; Provisional 96.95
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 96.92
PF1337173 TPR_9: Tetratricopeptide repeat 96.91
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.91
PF1337173 TPR_9: Tetratricopeptide repeat 96.91
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.89
KOG4210285 consensus Nuclear localization sequence binding pr 96.83
KOG1129478 consensus TPR repeat-containing protein [General f 96.83
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.81
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 96.78
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 96.77
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 96.77
KOG0151 877 consensus Predicted splicing regulator, contains R 96.77
COG4783484 Putative Zn-dependent protease, contains TPR repea 96.71
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 96.69
KOG0553304 consensus TPR repeat-containing protein [General f 96.67
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 96.62
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 96.58
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.55
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.49
KOG0624504 consensus dsRNA-activated protein kinase inhibitor 96.45
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.42
PRK11906458 transcriptional regulator; Provisional 96.41
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 96.34
KOG36171416 consensus WD40 and TPR repeat-containing protein [ 96.31
KOG3152 278 consensus TBP-binding protein, activator of basal 96.3
PF12688120 TPR_5: Tetratrico peptide repeat 96.2
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 96.2
KOG3785 557 consensus Uncharacterized conserved protein [Funct 96.18
KOG0110 725 consensus RNA-binding protein (RRM superfamily) [G 96.1
KOG0120 500 consensus Splicing factor U2AF, large subunit (RRM 96.1
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 96.09
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.08
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.9
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.87
CHL00033168 ycf3 photosystem I assembly protein Ycf3 95.75
PRK10803263 tol-pal system protein YbgF; Provisional 95.73
KOG0553304 consensus TPR repeat-containing protein [General f 95.72
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.67
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 95.62
PRK02603172 photosystem I assembly protein Ycf3; Provisional 95.51
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 95.49
PRK10153517 DNA-binding transcriptional activator CadC; Provis 95.43
KOG4660 549 consensus Protein Mei2, essential for commitment t 95.4
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 95.37
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 95.31
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 95.28
KOG1127 1238 consensus TPR repeat-containing protein [RNA proce 95.24
PRK10803263 tol-pal system protein YbgF; Provisional 95.2
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 95.17
PF1343134 TPR_17: Tetratricopeptide repeat 95.11
PF03704146 BTAD: Bacterial transcriptional activator domain; 95.06
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 94.75
PLN03098453 LPA1 LOW PSII ACCUMULATION1; Provisional 94.62
PRK11906458 transcriptional regulator; Provisional 94.58
CHL00033168 ycf3 photosystem I assembly protein Ycf3 94.48
PF1343134 TPR_17: Tetratricopeptide repeat 94.37
PF13512142 TPR_18: Tetratricopeptide repeat 94.36
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 94.3
PF12688120 TPR_5: Tetratrico peptide repeat 94.26
KOG0129 520 consensus Predicted RNA-binding protein (RRM super 93.38
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 93.37
PF06552186 TOM20_plant: Plant specific mitochondrial import r 92.53
PF03704146 BTAD: Bacterial transcriptional activator domain; 92.26
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 92.25
PF13512142 TPR_18: Tetratricopeptide repeat 92.21
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 92.01
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 91.93
PRK15331165 chaperone protein SicA; Provisional 91.52
KOG0129 520 consensus Predicted RNA-binding protein (RRM super 91.48
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 91.14
PF06552186 TOM20_plant: Plant specific mitochondrial import r 91.12
KOG1457 284 consensus RNA binding protein (contains RRM repeat 91.08
KOG3824472 consensus Huntingtin interacting protein HYPE [Gen 91.06
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 90.5
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 90.48
KOG0550486 consensus Molecular chaperone (DnaJ superfamily) [ 90.4
KOG1995 351 consensus Conserved Zn-finger protein [General fun 90.27
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 90.05
KOG2376652 consensus Signal recognition particle, subunit Srp 90.03
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 90.01
KOG0548539 consensus Molecular co-chaperone STI1 [Posttransla 89.68
KOG1457284 consensus RNA binding protein (contains RRM repeat 89.62
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 89.57
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 88.99
PRK15331165 chaperone protein SicA; Provisional 88.93
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 88.73
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 88.48
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 88.45
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 88.2
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 87.96
KOG3824 472 consensus Huntingtin interacting protein HYPE [Gen 87.8
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 87.69
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.73
KOG4234271 consensus TPR repeat-containing protein [General f 86.65
KOG4555175 consensus TPR repeat-containing protein [Function 86.39
KOG1855 484 consensus Predicted RNA-binding protein [General f 86.29
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 86.05
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 85.91
COG1729262 Uncharacterized protein conserved in bacteria [Fun 85.6
PF04184539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 85.51
KOG3081299 consensus Vesicle coat complex COPI, epsilon subun 85.5
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 85.49
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 84.71
TIGR0299642 rpt_mate_G_obs repeat-companion domain TIGR02996. 84.03
KOG4555175 consensus TPR repeat-containing protein [Function 83.66
KOG0543397 consensus FKBP-type peptidyl-prolyl cis-trans isom 83.44
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 82.77
KOG0115 275 consensus RNA-binding protein p54nrb (RRM superfam 82.65
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 82.59
PF15297353 CKAP2_C: Cytoskeleton-associated protein 2 C-termi 82.24
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 82.15
KOG1166 974 consensus Mitotic checkpoint serine/threonine prot 81.87
COG1729262 Uncharacterized protein conserved in bacteria [Fun 81.7
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 81.16
PF15297353 CKAP2_C: Cytoskeleton-associated protein 2 C-termi 80.71
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 80.62
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=3.9e-39  Score=315.77  Aligned_cols=409  Identities=29%  Similarity=0.467  Sum_probs=295.6

Q ss_pred             HhHHHHHhcCCCCChHhHHHHHHHHHHHHhcCChhhHHHHHHHHHhcCCCCHHHHHHHHHHHHhhccchhHHHHHHHHHH
Q 013667            6 AHLEEQISRQDLSDSEKFQQYMIYLKYEQSSGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVRDVYSRAT   85 (438)
Q Consensus         6 ~~~E~~l~~~~~~~~~~~~~w~~Y~~~e~~~g~~~~~~~~yERal~~~p~~~~lW~~Y~~~l~~~~~~~~~~~~i~erAl   85 (438)
                      ..||..++..+.    .++.|+.|+++|.+.|++-+++.+|||++..++.+.++|+.|..|+....+-+..+..++-||+
T Consensus       299 ~~~e~~~q~~~~----~~q~~~~yidfe~~~G~p~ri~l~~eR~~~E~~~~~~~wi~y~~~~d~eLkv~~~~~~~~~ra~  374 (881)
T KOG0128|consen  299 FKFERLVQKEPI----KDQEWMSYIDFEKKSGDPVRIQLIEERAVAEMVLDRALWIGYGVYLDTELKVPQRGVSVHPRAV  374 (881)
T ss_pred             HHHHHHhhhhHH----HHHHHHHHHHHHHhcCCchHHHHHHHHHHHhccccHHHHhhhhhhcccccccccccccccchhh
Confidence            456666666654    7889999999999999999999999999999999999999999999988888888999999999


Q ss_pred             HcCCCCHHHHHHHHHHHHHccCCHHHHHHHHHHHHhCCcccHHHHHHHHHHHHHHHHHhhhcccccchhhcHHHHHHHHH
Q 013667           86 KNCPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQ  165 (438)
Q Consensus        86 ~~~p~~~~lW~~y~~~le~~~~~~~~~~~i~~ral~~~~~~~~~~~~~~~~~~~~l~rr~~~~~~~~~~~~~~~~r~~f~  165 (438)
                      ++|||.+.||..|+..|++.......|...|+++++.++.       ++..+.-+.++....    ....+++.+|.+|.
T Consensus       375 R~cp~tgdL~~rallAleR~re~~~vI~~~l~~~ls~~~~-------l~~~~~~~rr~~~~~----~~s~~~s~lr~~F~  443 (881)
T KOG0128|consen  375 RSCPWTGDLWKRALLALERNREEITVIVQNLEKDLSMTVE-------LHNDYLAYRRRCTNI----IDSQDYSSLRAAFN  443 (881)
T ss_pred             cCCchHHHHHHHHHHHHHhcCcchhhHHHHHHHHHHHHHH-------HHHHHHHHHHhhccc----chhhhHHHHHHHHH
Confidence            9999999999999999999888888899999998875443       222222222222211    12367889999999


Q ss_pred             HHHHHHhhhhcC-CchhHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccchHH-HHHHHHHHHHhcccHHHHHHHHHHH
Q 013667          166 RASDYLSEQMKN-TDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLE-AWQSYISMEIELDHINEARSIYKRC  243 (438)
Q Consensus       166 ~a~~~l~~~~~~-~~~~~~l~~~~a~~e~~~~~~~~~ar~i~e~~l~~~~~~~~-~W~~y~~~e~~~g~~~~ar~i~~ra  243 (438)
                      +|+.+|...+.. .++.+.+...|+++|..++++++.||.||+.++........ .|+.|+++|..+|+...||.++++|
T Consensus       444 ~A~~eLt~~~~~~~Dt~~~~~q~wA~~E~sl~~nmd~~R~iWn~imty~~~~iag~Wle~~~lE~~~g~~~~~R~~~R~a  523 (881)
T KOG0128|consen  444 HAWEELTELYGDQLDTRTEVLQLWAQVEASLLKNMDKAREIWNFIMTYGGGSIAGKWLEAINLEREYGDGPSARKVLRKA  523 (881)
T ss_pred             HHHHHHHHHhhhhhhhHHHHHHHHHHHHHHHhhchhhhhHhhhccccCCcchHHHHHHHHHhHHHHhCCchhHHHHHHHH
Confidence            999999999887 88899999999999999999999999999999998665565 9999999999999999999999999


Q ss_pred             HhcccCCCChHHHHHHHHHHHHHhCCHHHHHHHHHhhhhhHHHHHHHHHHhhhccCCCchhhhhhhhccccccccCCCCC
Q 013667          244 YSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQESKSLPESADQKEHSVKKTGREKRKSDSN  323 (438)
Q Consensus       244 l~~~~~~~~~~~i~~~~~~fE~~~G~~~~~~~a~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~krk~~~~  323 (438)
                      +.....++....+++.|..||+++|+++.+..|..+++++.......+.+...+...+.+     ..++..+.+++....
T Consensus       524 y~~~~~~~~~~ev~~~~~r~Ere~gtl~~~~~~~~~~~pr~~~~~~~~~e~~s~~v~p~~-----~~ke~~~~~~k~~~~  598 (881)
T KOG0128|consen  524 YSQVVDPEDALEVLEFFRRFEREYGTLESFDLCPEKVLPRVYEAPLERREKESTNVYPEQ-----QKKEIQRRQFKGEGN  598 (881)
T ss_pred             HhcCcCchhHHHHHHHHHHHHhccccHHHHhhhHHhhcchhhhhhhhhhhhcccCCCcch-----hhHHhhHHHhhcccc
Confidence            986544444568999999999999999999999999999887666555555544322211     111111111221111


Q ss_pred             CCccCCchhhcccCCC----CCCccchhhHHhhhhhhhhhccccccccccCCCCCCC-CcCCCCCCCCCCCCCceEEEeC
Q 013667          324 ISYEQSPAKRQKHAPQ----KPKKVHDKEKRQVQNLAEENEGRETKQTVEEQPKKQP-IKDAVPGRTKGFTDECTAFLSN  398 (438)
Q Consensus       324 ~~~~~~~~K~~k~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~v~v~n  398 (438)
                      ...-.-|.++.|...+    .....++.    .++.+..+.|..+......++..++ +.......++..++.+++||+|
T Consensus       599 vekv~~p~~g~k~h~q~~~~~~~s~~~~----~esat~pa~~~~a~~~~av~~ad~~~~~~~~kvs~n~~R~~~~~fvsn  674 (881)
T KOG0128|consen  599 VEKVNGPKRGFKAHEQPQQQKVQSKHGS----AESATVPAGGALANRSAAVGLADAEEKEENFKVSPNEIRDLIKIFVSN  674 (881)
T ss_pred             cccccCccccccccccchhhhhhccccc----hhhcccccccccCCccccCCCCCchhhhhccCcCchHHHHHHHHHHhh
Confidence            1111112222221111    00001111    0111111111111111111111111 1122333334446778999999


Q ss_pred             CCCCCCHHHHHHHhcCCCCeeEEEEeecCCCCCCcceeeC
Q 013667          399 INLKATYEDLRRFFSDVGGVSSIRILHDKFTGKSRVSFFL  438 (438)
Q Consensus       399 l~~~~~~~~l~~~f~~~G~i~~~~~~~~~~~~~~~g~~fv  438 (438)
                      |+..+.+.+|...|..+|.+..+++.....+|+.||.|||
T Consensus       675 l~~~~~~~dl~~~~~~~~~~e~vqi~~h~n~~~~rG~~Y~  714 (881)
T KOG0128|consen  675 LSPKMSEEDLSERFSPSGTIEVVQIVIHKNEKRFRGKAYV  714 (881)
T ss_pred             cchhhcCchhhhhcCccchhhhHHHHHHhhccccccceee
Confidence            9999999999999999999999988866678999999986

>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1915 consensus Cell cycle control protein (crooked neck) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>KOG2047 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0495 consensus HAT repeat protein [RNA processing and modification] Back     alignment and domain information
>KOG1070 consensus rRNA processing protein Rrp5 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG2396 consensus HAT (Half-A-TPR) repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1258 consensus mRNA processing protein [RNA processing and modification] Back     alignment and domain information
>COG5107 RNA14 Pre-mRNA 3'-end processing (cleavage and polyadenylation) factor [RNA processing and modification] Back     alignment and domain information
>KOG1914 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA14 [RNA processing and modification] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG4626 consensus O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2076 consensus RNA polymerase III transcription factor TFIIIC [Transcription] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG0547 consensus Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG1155 consensus Anaphase-promoting complex (APC), Cdc23 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1125 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1126 consensus DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3060 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF08311 Mad3_BUB1_I: Mad3/BUB1 homology region 1; InterPro: IPR013212 Proteins containing this domain are checkpoint proteins involved in cell division Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG2002 consensus TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>KOG1173 consensus Anaphase-promoting complex (APC), Cdc16 subunit [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1156 consensus N-terminal acetyltransferase [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG1840 consensus Kinesin light chain [Cytoskeleton] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF02184 HAT: HAT (Half-A-TPR) repeat; InterPro: IPR003107 The HAT (Half A TPR) repeat has a repetitive pattern characterised by three aromatic residues with a conserved spacing Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>smart00777 Mad3_BUB1_I Mad3/BUB1 hoMad3/BUB1 homology region 1 Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1128 consensus Uncharacterized conserved protein, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG2003 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG1174 consensus Anaphase-promoting complex (APC), subunit 7 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4162 consensus Predicted calmodulin-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1129 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>KOG0624 consensus dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains [Defense mechanisms] Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3617 consensus WD40 and TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG3785 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG0553 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG1127 consensus TPR repeat-containing protein [RNA processing and modification] Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0550 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG2376 consensus Signal recognition particle, subunit Srp72 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0548 consensus Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>KOG3824 consensus Huntingtin interacting protein HYPE [General function prediction only] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG4234 consensus TPR repeat-containing protein [General function prediction only] Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3081 consensus Vesicle coat complex COPI, epsilon subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>TIGR02996 rpt_mate_G_obs repeat-companion domain TIGR02996 Back     alignment and domain information
>KOG4555 consensus TPR repeat-containing protein [Function unknown] Back     alignment and domain information
>KOG0543 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF15297 CKAP2_C: Cytoskeleton-associated protein 2 C-terminus Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF15297 CKAP2_C: Cytoskeleton-associated protein 2 C-terminus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query438
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-30
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 2e-07
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 8e-28
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-09
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 2e-07
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 6e-04
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 5e-26
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 8e-25
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 7e-14
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 1e-04
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 5e-12
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 6e-11
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 9e-09
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 6e-08
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 4e-07
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 4e-07
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-07
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 9e-07
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 9e-07
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 1e-06
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-06
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-06
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-06
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-06
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-06
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-06
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-06
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 4e-06
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 4e-06
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 5e-06
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 5e-06
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-06
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-06
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 7e-06
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 9e-06
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-05
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-05
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 2e-05
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 7e-05
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 2e-05
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-05
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-05
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-05
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-05
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 4e-05
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-05
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 5e-05
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 5e-05
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 6e-05
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 6e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-05
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-05
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-05
1fxl_A 167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-04
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-05
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 7e-05
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 8e-04
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 8e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-05
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 8e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-04
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-04
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 2e-04
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-04
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-04
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 2e-04
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-04
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-04
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-04
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-04
3p5t_L90 Cleavage and polyadenylation specificity factor S; 2e-04
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-04
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-04
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-04
3n9u_C156 Cleavage and polyadenylation specificity factor S; 3e-04
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 4e-04
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 4e-04
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-04
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-04
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-04
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 5e-04
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 6e-04
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 6e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 8e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 8e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 9e-04
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
 Score =  123 bits (308), Expect = 2e-30
 Identities = 42/351 (11%), Positives = 109/351 (31%), Gaps = 20/351 (5%)

Query: 9   EEQISRQDLSDSEKFQQYMIYLKYE-------QSSGDPGRVQLLYERAITDFPVSSDLWL 61
           E  + + +  D ++   ++ ++++E              R+  +Y +A      + ++W 
Sbjct: 288 ESNLPKPNEYDVQQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFAPEIWF 347

Query: 62  DYTQYLDKTLKVGNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEE--EISTVFEKS 119
           +   Y  +      V+        +  P    L        E +    E           
Sbjct: 348 NMANYQGEKNTDSTVITKYLKLGQQCIPNSAVLAFSLSEQYELNTKIPEIETTILSCIDR 407

Query: 120 LLCAFSTFEEYLDLFLTRIDGLRRR-----ILFSGEVEGVLDYSLIRETFQRASDYLSEQ 174
           +    +   E      + I+ L+ +      ++   ++ +   +  R+ F +        
Sbjct: 408 IHLDLAALMEDDPTNESAINQLKSKLTYVYCVYMNTMKRIQGLAASRKIFGKCRRLKKLV 467

Query: 175 MKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHIN 234
             +       Y   A++E  + KD  +A  V E  LK      E    Y+   I ++  +
Sbjct: 468 TPDI------YLENAYIEYHISKDTKTACKVLELGLKYFATDGEYINKYLDFLIYVNEES 521

Query: 235 EARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEELRLFRSQQ 294
           + +S+++    K       + I    + FE + G+L       ++   +  E+       
Sbjct: 522 QVKSLFESSIDKISDSHLLKMIFQKVIFFESKVGSLNSVRTLEKRFFEKFPEVNKLEEFT 581

Query: 295 ESKSLPESADQKEHSVKKTGREKRKSDSNISYEQSPAKRQKHAPQKPKKVH 345
               + +    +   +    R+       +    +  KR     +  +   
Sbjct: 582 NKYKVLDVNYLQRLELDYMVRDVMPEAIALDRGSNNLKRTMREEEDGQAFK 632
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Length = 679 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Length = 530 Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Length = 308 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Length = 493 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
4e6h_A679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.97
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.93
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.93
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 99.93
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.9
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 99.88
2uy1_A493 Cleavage stimulation factor 77; RNA-binding protei 99.87
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.84
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.55
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.55
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.54
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.52
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.52
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.52
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.5
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.5
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.47
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.47
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.47
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.46
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.45
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.44
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.44
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.43
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.42
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 99.42
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.41
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.39
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.37
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.37
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.36
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.35
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.35
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.34
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 99.34
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.34
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.33
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.32
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.31
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.31
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.31
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.3
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.29
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.27
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.27
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.26
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.26
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.25
3u4t_A272 TPR repeat-containing protein; structural genomics 99.24
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.24
3u4t_A272 TPR repeat-containing protein; structural genomics 99.24
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.24
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.24
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.24
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.23
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.23
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.23
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.23
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.22
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.22
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.21
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.21
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.21
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 99.21
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.21
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.2
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.2
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.2
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.2
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.19
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.19
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.19
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.19
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.19
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.19
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.19
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.19
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.19
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.19
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.18
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.18
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.18
2div_A99 TRNA selenocysteine associated protein; structural 99.18
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.18
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.18
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.18
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.18
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.18
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.17
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.17
2gw1_A514 Mitochondrial precursor proteins import receptor; 99.17
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.17
4g1t_A472 Interferon-induced protein with tetratricopeptide 99.17
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.17
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.17
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.17
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.16
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.16
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.16
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.16
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.15
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.15
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.15
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.15
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.15
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.14
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.14
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.14
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.13
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.13
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.12
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.12
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.12
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.12
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.11
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.11
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.11
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.11
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.11
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.11
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.1
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.1
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.1
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.1
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.1
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.1
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.09
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.09
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.09
2dis_A109 Unnamed protein product; structural genomics, RRM 99.09
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.08
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 99.08
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.07
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.07
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.07
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.07
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.07
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.07
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.07
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.06
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.05
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.05
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.05
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.03
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.03
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.03
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.03
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.03
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.02
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.02
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 99.02
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.02
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.02
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.01
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.0
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.0
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.0
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.99
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.99
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.98
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.97
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.97
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 98.97
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.96
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.94
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.94
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.94
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 98.47
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.93
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.91
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.91
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.91
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.91
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 98.91
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.9
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.89
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.89
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.88
4g1t_A472 Interferon-induced protein with tetratricopeptide 98.87
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 98.86
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.86
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.85
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.85
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.85
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.84
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.84
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.84
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.84
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.83
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.83
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.82
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.81
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.81
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.81
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.8
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.8
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 98.8
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.8
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.79
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.78
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.78
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 98.77
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.77
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.77
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.77
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.77
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.76
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.76
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.76
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.75
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.73
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.73
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.73
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.72
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.72
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 98.71
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.71
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.71
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.7
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.7
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.7
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.7
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.7
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.69
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.69
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.69
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.68
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.68
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.67
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.66
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.66
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.66
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.65
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.65
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.65
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.65
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.64
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.63
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.62
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.6
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.6
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.6
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.59
1x5p_A97 Negative elongation factor E; structure genomics, 98.59
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.58
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.57
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.57
3dss_A331 Geranylgeranyl transferase type-2 subunit alpha; p 98.57
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.57
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.56
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.53
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.53
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.51
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 98.51
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 98.5
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.49
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.48
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.47
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.47
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.46
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.45
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.43
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.43
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.42
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.42
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.42
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.41
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 98.41
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 98.4
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.39
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.38
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.38
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 98.37
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.35
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.34
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 98.34
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.34
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.33
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.33
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.32
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 98.32
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.32
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.31
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.31
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 98.31
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 98.29
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 98.29
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.29
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 98.29
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 98.27
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.26
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.26
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.22
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.21
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.2
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.18
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.18
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.18
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.17
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.17
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.12
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.11
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.09
4a1g_A152 Mitotic checkpoint serine/threonine-protein kinas; 98.09
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.07
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.07
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.07
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 98.06
3esl_A202 Checkpoint serine/threonine-protein kinase BUB1; m 98.06
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.04
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.03
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.02
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.02
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.01
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.01
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.0
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.0
3q15_A378 PSP28, response regulator aspartate phosphatase H; 98.0
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 98.0
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.99
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.99
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.98
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 97.98
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.97
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.97
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.95
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.94
2dit_A112 HIV TAT specific factor 1 variant; structural geno 97.93
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 97.9
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 97.9
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 97.9
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.9
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.88
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 97.87
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 97.87
2wvi_A164 Mitotic checkpoint serine/threonine-protein kinase 97.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.85
3k9i_A117 BH0479 protein; putative protein binding protein, 97.85
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 97.84
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 97.83
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.82
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 97.82
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.81
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.8
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.79
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.79
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.76
3q49_B137 STIP1 homology and U box-containing protein 1; E3 97.76
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.76
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.75
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 97.74
4aez_C223 MAD3, mitotic spindle checkpoint component MAD3; c 97.72
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 97.69
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.69
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.68
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.68
3k9i_A117 BH0479 protein; putative protein binding protein, 97.67
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.67
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 97.65
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.63
2kat_A115 Uncharacterized protein; NESG, structure, structur 97.62
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 97.62
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 97.6
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.6
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.6
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 97.6
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 97.58
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.54
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.5
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.49
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.48
2l6j_A111 TPR repeat-containing protein associated with HSP; 97.45
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 97.36
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.36
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 97.36
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.35
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.34
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 97.34
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.34
1xi4_A1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 97.33
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 97.32
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 97.24
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.23
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 97.13
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 97.05
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 97.01
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.98
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.98
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 96.95
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.92
2l6j_A111 TPR repeat-containing protein associated with HSP; 96.9
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.9
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 96.89
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 96.87
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.76
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.76
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 96.71
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.62
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.59
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.46
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 96.45
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.38
1b89_A449 Protein (clathrin heavy chain); triskelion, coated 96.38
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 96.27
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 96.19
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 96.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 96.1
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 95.81
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.81
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 94.77
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 94.45
1pc2_A152 Mitochondria fission protein; unknown function; NM 93.15
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 92.43
1klx_A138 Cysteine rich protein B; structural genomics, heli 91.4
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 91.22
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 89.29
3qww_A433 SET and MYND domain-containing protein 2; methyltr 89.25
1pc2_A152 Mitochondria fission protein; unknown function; NM 88.66
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 86.74
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 86.47
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 86.4
1klx_A138 Cysteine rich protein B; structural genomics, heli 83.88
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 81.41
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 80.71
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
Probab=99.97  E-value=9.1e-29  Score=255.01  Aligned_cols=243  Identities=15%  Similarity=0.184  Sum_probs=200.5

Q ss_pred             HhHHHHHHHHHHHHhcC-------ChhhHHHHHHHHHhcCCCCHHHHHHHHHHHHhhccchhHHH-HHHHHHHHcCCCCH
Q 013667           21 EKFQQYMIYLKYEQSSG-------DPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLKVGNVVR-DVYSRATKNCPWVG   92 (438)
Q Consensus        21 ~~~~~w~~Y~~~e~~~g-------~~~~~~~~yERal~~~p~~~~lW~~Y~~~l~~~~~~~~~~~-~i~erAl~~~p~~~   92 (438)
                      .....|..|++||+.++       ...+++.+|++||..+|.++++|++|+.|+...+. .+.++ .+|+||+.+||++.
T Consensus       300 ~ql~lW~~yi~fEk~~~~~l~~~~~~~Rv~~~Ye~aL~~~p~~~~lW~~ya~~~~~~~~-~~~a~r~il~rAi~~~P~s~  378 (679)
T 4e6h_A          300 QQLLIWLEWIRWESDNKLELSDDLHKARMTYVYMQAAQHVCFAPEIWFNMANYQGEKNT-DSTVITKYLKLGQQCIPNSA  378 (679)
T ss_dssp             HHHHHHHHHHHHHHTCTTCCCHHHHHHHHHHHHHHHHHHTTTCHHHHHHHHHHHHHHSC-CTTHHHHHHHHHHHHCTTCH
T ss_pred             HHHHHHHHHHHHHHhCCccccchhhHHHHHHHHHHHHHHcCCCHHHHHHHHHHHHhcCc-HHHHHHHHHHHHHHhCCCCH
Confidence            55789999999999875       24678999999999999999999999999987754 45575 99999999999999


Q ss_pred             HHHHHHHHHHHHccCCHHHHHHHHHHHHhCCcccH------------------HHHHHHHHHHHHHHHHhhhcccccchh
Q 013667           93 ELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTF------------------EEYLDLFLTRIDGLRRRILFSGEVEGV  154 (438)
Q Consensus        93 ~lW~~y~~~le~~~~~~~~~~~i~~ral~~~~~~~------------------~~~~~~~~~~~~~l~rr~~~~~~~~~~  154 (438)
                      .||..|+.+.+. .++.+.++.||++++...+...                  ...-.+|..++.+.+|.          
T Consensus       379 ~Lwl~~a~~ee~-~~~~e~aR~iyek~l~~l~~~~~~~~~~~p~~~~~~~~~~~~~~~vWi~y~~~erR~----------  447 (679)
T 4e6h_A          379 VLAFSLSEQYEL-NTKIPEIETTILSCIDRIHLDLAALMEDDPTNESAINQLKSKLTYVYCVYMNTMKRI----------  447 (679)
T ss_dssp             HHHHHHHHHHHH-TTCHHHHHHHHHHHHHHHHHHHHHHHHHSTTCHHHHHHHHHHHHHHHHHHHHHHHHH----------
T ss_pred             HHHHHHHHHHHH-hCCHHHHHHHHHHHHHHHHHHhhhhhhccCcchhhhhhhccchHHHHHHHHHHHHHc----------
Confidence            999999997666 6779999999999997532100                  01334677777666543          


Q ss_pred             hcHHHHHHHHHHHHHHHhhhhcCCchhHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccchHHHHHHHHHHHHhcccHH
Q 013667          155 LDYSLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHIN  234 (438)
Q Consensus       155 ~~~~~~r~~f~~a~~~l~~~~~~~~~~~~l~~~~a~~e~~~~~~~~~ar~i~e~~l~~~~~~~~~W~~y~~~e~~~g~~~  234 (438)
                      .+++.+|.+|.+|++.+      ......+|..+|.+|...+++++.||+||+++|+.+|+...+|+.|++|+...|+.+
T Consensus       448 ~~l~~AR~vf~~A~~~~------~~~~~~lyi~~A~lE~~~~~d~e~Ar~ife~~Lk~~p~~~~~w~~y~~fe~~~~~~~  521 (679)
T 4e6h_A          448 QGLAASRKIFGKCRRLK------KLVTPDIYLENAYIEYHISKDTKTACKVLELGLKYFATDGEYINKYLDFLIYVNEES  521 (679)
T ss_dssp             HCHHHHHHHHHHHHHTG------GGSCTHHHHHHHHHHHTTTSCCHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHTCHH
T ss_pred             CCHHHHHHHHHHHHHhc------CCCChHHHHHHHHHHHHhCCCHHHHHHHHHHHHHHCCCchHHHHHHHHHHHhCCCHH
Confidence            45678889999987752      122356899999999998867999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHhcccCCCChHHHHHHHHHHHHHhCCHHHHHHHHHhhh
Q 013667          235 EARSIYKRCYSKRFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVT  281 (438)
Q Consensus       235 ~ar~i~~ral~~~~~~~~~~~i~~~~~~fE~~~G~~~~~~~a~~~~~  281 (438)
                      +||.+|++|+....+...+..+|..|++||..+|+++++..+..++.
T Consensus       522 ~AR~lferal~~~~~~~~~~~lw~~~~~fE~~~G~~~~~~~v~~R~~  568 (679)
T 4e6h_A          522 QVKSLFESSIDKISDSHLLKMIFQKVIFFESKVGSLNSVRTLEKRFF  568 (679)
T ss_dssp             HHHHHHHHHTTTSSSTTHHHHHHHHHHHHHHHTCCSHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHH
Confidence            99999999998532233578999999999999999999888776654
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>4a1g_A Mitotic checkpoint serine/threonine-protein kinas; cell cycle, transferase, spindle assembly checkpoint, mitosi repeat, KNL1, KMN network; 2.60A {Homo sapiens} PDB: 2lah_A Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3esl_A Checkpoint serine/threonine-protein kinase BUB1; mitotic spindle checkpoint, TPR motif, all-alpha domain, MAD3-like domain; HET: NHE; 1.74A {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2wvi_A Mitotic checkpoint serine/threonine-protein kinase BUB1 beta; tumor suppressor, TPR, apoptosis, cell division, cell cycle, kinetochore, transferase; 1.80A {Homo sapiens} PDB: 3si5_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>4aez_C MAD3, mitotic spindle checkpoint component MAD3; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 438
d2onda1308 a.118.8.7 (A:242-549) Cleavage stimulation factor 1e-19
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 4e-06
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 6e-04
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 0.004
d1u1qa_ 183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 0.004
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 0.004
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 308 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 86.6 bits (213), Expect = 1e-19
 Identities = 51/291 (17%), Positives = 101/291 (34%), Gaps = 46/291 (15%)

Query: 19  DSEKFQQYMIYLKYEQS--------SGDPGRVQLLYERAITDFPVSSDLWLDYTQYLDKT 70
           ++++   +  Y+++E+S        +    RV   YE+ +       D+W +  QYL+++
Sbjct: 4   EAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQS 63

Query: 71  LKV-------------GNVVRDVYSRATKNCPWVGELWVRSLLSLERSRASEEEISTVFE 117
            K+              +   ++Y RA         L   +    E SR   E++ +++ 
Sbjct: 64  SKLLAEKGDMNNAKLFSDEAANIYERAISTLLKKNMLLYFAYADYEESRMKYEKVHSIYN 123

Query: 118 KSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDYSLIRETFQRASDYLSEQMKN 177
           + L             +                    + ++   E  +       +  ++
Sbjct: 124 RLLAIEDIDPTLVYIQY--------------------MKFARRAEGIKSGRMIFKKARED 163

Query: 178 TDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEAR 237
                 +Y   A +E    KD   A  ++E  LK  G + E   +YI     L+  N  R
Sbjct: 164 ARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTR 223

Query: 238 SIYKRCYSK-RFTGTGSEDICHAWLRFEREYGTLEDFDHSVQKVTPRLEEL 287
            +++R  +        S +I   +L FE   G L     S+ KV  R    
Sbjct: 224 VLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLA----SILKVEKRRFTA 270
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query438
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.97
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 99.89
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.47
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.46
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.45
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.43
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.43
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.42
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.41
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.41
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.39
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.39
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.39
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.39
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.38
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.38
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.38
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.37
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.37
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.37
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.36
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.35
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.35
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.35
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.34
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.33
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.33
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.3
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.3
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.29
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.29
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.28
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.27
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.27
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.25
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.23
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.21
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.2
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.18
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.18
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.17
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.17
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.17
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.17
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.15
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.14
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.12
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.12
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.11
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.1
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.09
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.09
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.08
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.07
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.04
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.03
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.01
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.99
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.99
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.98
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 98.95
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.94
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.93
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.93
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.93
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.92
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.92
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.92
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.9
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.84
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.84
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.79
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.79
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.79
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.78
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.78
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.77
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.77
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.76
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.75
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.75
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.74
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.74
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.7
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.7
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.7
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.66
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.6
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.59
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.5
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.41
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.36
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.25
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.24
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.23
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.2
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 98.18
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.18
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.18
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.12
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.08
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.0
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 97.95
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.78
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.71
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 97.69
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 97.69
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.6
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.56
d1hz4a_366 Transcription factor MalT domain III {Escherichia 97.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.53
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 97.5
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 97.47
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.35
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 97.32
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 97.26
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 97.25
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.22
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 97.21
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 97.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 97.09
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.92
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 96.87
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 96.83
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.72
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.7
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.53
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.44
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 96.25
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 96.14
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 95.79
d1ya0a1497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 95.38
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 94.09
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 93.86
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 92.06
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 88.19
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 87.76
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 86.53
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: HAT/Suf repeat
domain: Cleavage stimulation factor 77 kDa subunit CSTF3
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.97  E-value=4.3e-30  Score=240.61  Aligned_cols=240  Identities=21%  Similarity=0.280  Sum_probs=192.8

Q ss_pred             hHhHHHHHHHHHHHHhcC--------ChhhHHHHHHHHHhcCCCCHHHHHHHHHHHHhhcc-------------chhHHH
Q 013667           20 SEKFQQYMIYLKYEQSSG--------DPGRVQLLYERAITDFPVSSDLWLDYTQYLDKTLK-------------VGNVVR   78 (438)
Q Consensus        20 ~~~~~~w~~Y~~~e~~~g--------~~~~~~~~yERal~~~p~~~~lW~~Y~~~l~~~~~-------------~~~~~~   78 (438)
                      ...++.|+.|++||+.++        ...+|..+|||||..+|.++++|+.|+.|+...++             ..+.++
T Consensus         5 ~~~~~~W~~yi~~E~~~~~~~~~~~~~~~Rv~~vyerAl~~~~~~~~lW~~y~~~~~~~~~~~~~~~~~~~~~~~~~~a~   84 (308)
T d2onda1           5 AQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHHPDIWYEAAQYLEQSSKLLAEKGDMNNAKLFSDEAA   84 (308)
T ss_dssp             HHHHHHHHHHHHHHHTCTTCCCCHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHTSCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHhCcccccccchhHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHcCchHHHHHHHhhcccchHHHH
Confidence            346789999999998765        25689999999999999999999999999875431             235689


Q ss_pred             HHHHHHHHc-CCCCHHHHHHHHHHHHHccCCHHHHHHHHHHHHhCCcccHHHHHHHHHHHHHHHHHhhhcccccchhhcH
Q 013667           79 DVYSRATKN-CPWVGELWVRSLLSLERSRASEEEISTVFEKSLLCAFSTFEEYLDLFLTRIDGLRRRILFSGEVEGVLDY  157 (438)
Q Consensus        79 ~i~erAl~~-~p~~~~lW~~y~~~le~~~~~~~~~~~i~~ral~~~~~~~~~~~~~~~~~~~~l~rr~~~~~~~~~~~~~  157 (438)
                      .+|+|||.. +|.+..+|..|+.+++ ..++.+.++.+|++++...+...   ..+|..++.++++.          .++
T Consensus        85 ~i~~ral~~~~p~~~~l~~~ya~~~~-~~~~~~~a~~i~~~~l~~~~~~~---~~~w~~~~~~~~~~----------~~~  150 (308)
T d2onda1          85 NIYERAISTLLKKNMLLYFAYADYEE-SRMKYEKVHSIYNRLLAIEDIDP---TLVYIQYMKFARRA----------EGI  150 (308)
T ss_dssp             HHHHHHHTTTTTTCHHHHHHHHHHHH-HTTCHHHHHHHHHHHHTSSSSCT---HHHHHHHHHHHHHH----------HCH
T ss_pred             HHHHHHHHHcCCCCHHHHHHHHHHHH-hcccHHHHHHHHHHHHHHhcCCh---HHHHHHHHHHHHHc----------CCh
Confidence            999999985 6888999999998555 47789999999999998766532   23445554444322          345


Q ss_pred             HHHHHHHHHHHHHHhhhhcCCchhHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHhccchHHHHHHHHHHHHhcccHHHHH
Q 013667          158 SLIRETFQRASDYLSEQMKNTDGLLRLYAYWAHLEQSMGKDMVSARGVWERLLKISGAMLEAWQSYISMEIELDHINEAR  237 (438)
Q Consensus       158 ~~~r~~f~~a~~~l~~~~~~~~~~~~l~~~~a~~e~~~~~~~~~ar~i~e~~l~~~~~~~~~W~~y~~~e~~~g~~~~ar  237 (438)
                      ..++.+|.+|+..       .+....+|..++.++....++.+.|+.+|++++..+|++..+|+.|++|+...|++++||
T Consensus       151 ~~ar~i~~~al~~-------~~~~~~~~~~~a~~e~~~~~~~~~a~~i~e~~l~~~p~~~~~w~~y~~~~~~~g~~~~aR  223 (308)
T d2onda1         151 KSGRMIFKKARED-------ARTRHHVYVTAALMEYYCSKDKSVAFKIFELGLKKYGDIPEYVLAYIDYLSHLNEDNNTR  223 (308)
T ss_dssp             HHHHHHHHHHHTS-------TTCCTHHHHHHHHHHHHTSCCHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCCHHHHH
T ss_pred             HHHHHHHHHHHHh-------CCCcHHHHHHHHHHHHHhccCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHcCChHHHH
Confidence            5666666666543       455567899999998877669999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcc-cCCCChHHHHHHHHHHHHHhCCHHHHHHHHHhh
Q 013667          238 SIYKRCYSKR-FTGTGSEDICHAWLRFEREYGTLEDFDHSVQKV  280 (438)
Q Consensus       238 ~i~~ral~~~-~~~~~~~~i~~~~~~fE~~~G~~~~~~~a~~~~  280 (438)
                      .+|++|+... .++.....||..|+.||..||+++++..+.+++
T Consensus       224 ~~fe~ai~~~~~~~~~~~~iw~~~~~fE~~~G~~~~~~~~~~r~  267 (308)
T d2onda1         224 VLFERVLTSGSLPPEKSGEIWARFLAFESNIGDLASILKVEKRR  267 (308)
T ss_dssp             HHHHHHHHSSSSCGGGCHHHHHHHHHHHHHHSCHHHHHHHHHHH
T ss_pred             HHHHHHHHhCCCChHHHHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            9999999842 122234679999999999999999988766554
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure