Citrus Sinensis ID: 013689

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44

MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR

cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

**SVFSADDFSDSF***************************************************************************************************YRAYLKTKLDLACAAVALRT***************************************************************************************************************AHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNV*************************************************************************************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASDNSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSHRDQSLDPPVIPSSTAPVDSDEYRAYLKTKLDLACAAVALRTAPVKPEDKSSLIENQTQAAKPSELGSQAMATGTHPKADFRPLGSADLPAVQARPAAQVRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRARRMLSNxxxxxxxxxxxxxxxxxxxxxxxxxxxxHSSLLKGLTDVNQKYDESAVNxxxxxxxxxxxxxxxxxxxxxxxxxxxxNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Basic leucine zipper 10	Transcription factor that binds to the C-box-like motif (5'-TGCTGACGTCA-3') and G-box-like motif (5'-CCACGTGGCC-3'), ABRE elements, of gene promoters. Binds to the 5'-ACGT-3' motif of seed storage protein (SSP) encoding gene promoters (e.g. At2S and CRU3) and promotes their expression in seeds when in complex with ABI3 and BZIP53. Involved in the defense responses to the biotrophic pathogen Hyaloperonospora parasitica and oxidative stress responses; mediates positively cell death.	probable	O22763

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WT7, chain A
Confidence level:confident
Coverage over the Query: 223-276
View the alignment between query and template
View the model in PyMOL

Template: 3U59, chain A
Confidence level:probable
Coverage over the Query: 229-310
View the alignment between query and template
View the model in PyMOL