Citrus Sinensis ID: 013689
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 438 | ||||||
| 255559911 | 441 | DNA binding protein, putative [Ricinus c | 0.954 | 0.947 | 0.479 | 2e-84 | |
| 118486477 | 445 | unknown [Populus trichocarpa] | 0.970 | 0.955 | 0.524 | 4e-84 | |
| 444300790 | 444 | bZIP transcription factor family protein | 0.890 | 0.878 | 0.445 | 4e-73 | |
| 225451342 | 423 | PREDICTED: light-inducible protein CPRF2 | 0.876 | 0.907 | 0.452 | 1e-70 | |
| 16797791 | 450 | bZIP transcription factor [Nicotiana tab | 0.908 | 0.884 | 0.431 | 2e-70 | |
| 351720703 | 417 | bZIP protein [Glycine max] gi|183014149| | 0.897 | 0.942 | 0.429 | 2e-68 | |
| 147796457 | 446 | hypothetical protein VITISV_022136 [Viti | 0.904 | 0.887 | 0.449 | 2e-68 | |
| 351725229 | 404 | bZIP transcription factor bZIP89 [Glycin | 0.876 | 0.950 | 0.441 | 5e-68 | |
| 225437201 | 452 | PREDICTED: light-inducible protein CPRF2 | 0.945 | 0.915 | 0.434 | 3e-67 | |
| 449458456 | 442 | PREDICTED: light-inducible protein CPRF2 | 0.942 | 0.934 | 0.459 | 2e-66 |
| >gi|255559911|ref|XP_002520974.1| DNA binding protein, putative [Ricinus communis] gi|223539811|gb|EEF41391.1| DNA binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 319 bits (817), Expect = 2e-84, Method: Compositional matrix adjust.
Identities = 221/461 (47%), Positives = 281/461 (60%), Gaps = 43/461 (9%)
Query: 1 MNSVFSADDFSDSFLSSPSPPPASFHALPMNRSQSEWELEKFLQEVTVSPRAISSSSASD 60
MNS+FS DDFSD +P M RS SEWELEKFL+E P + S ++
Sbjct: 1 MNSIFSVDDFSDLLWQAP-----------MTRSASEWELEKFLEEF---PASSSICDNNN 46
Query: 61 NSVPAVIGPSVMSKSRAYEIGDDDVVEIKKSH-RDQSLDPPVIPSSTAPVDSDEYRAYLK 119
N V P ++ S+ EI +D+VVEI+K Q LD +P P D+D Y A+LK
Sbjct: 47 NDTTTVAVPKSLTSSKRREICEDEVVEIEKVEINSQPLDRAPLP---PPEDTDGYHAFLK 103
Query: 120 TKLDLACAAVAL---RTAPVKPED-KSSLIENQTQAAKPSELGSQAMATGTHP------K 169
++LDLACAA A R + VKPE SS E+Q K E GS ++ H +
Sbjct: 104 SQLDLACAAAAAAKSRDSSVKPEGVSSSFAEDQRVINKNCESGSSPVSGNGHGITKGQNE 163
Query: 170 ADFRPLGSADLPAVQARPAAQ---VRQSTSGSSREDSDDDELEGDTETIEGLDSVDDKRA 226
AD GS LPA+ + P Q VRQ+TSGSSREDSDDDELEGDTET + +D D+KRA
Sbjct: 164 ADG---GSLRLPALPSMPRKQEVPVRQATSGSSREDSDDDELEGDTETNDNMDPADEKRA 220
Query: 227 RRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDESAVNNRILK 286
RRM SNRESARRSRRRKQA LNELE Q GQLR E +SLL LTD+N+K DE++V+NRIL
Sbjct: 221 RRMQSNRESARRSRRRKQAQLNELEAQVGQLRDERTSLLTRLTDINKKCDEASVDNRILN 280
Query: 287 ADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPN 346
A+IETLR KVKMAE+ VKRVTGLNP++LARS++P +GM V D S N PMQPN N
Sbjct: 281 ANIETLRTKVKMAEDQVKRVTGLNPMVLARSNMPNMGMQFVAGQTDVSANVAVPMQPNNN 340
Query: 347 QFFHQAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVG---- 402
FFH ++P +++ P+ Q L +S P+N P + G N+ +PLQ G
Sbjct: 341 HFFHHSVPDLTSGAPHLQRLSNSCPNNSVTPLATPLPVNNGTSNIGGIAPLQQVTGAQNM 400
Query: 403 -----LEHVPQGVGHRVSPPGAVPGWDTGLPHAGSKNNKQR 438
L+HV + G VSPP +V + GL +K+NK++
Sbjct: 401 TDVPPLQHVQKQTGPTVSPPASVLICNKGLSQPVAKDNKKK 441
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|118486477|gb|ABK95078.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|444300790|gb|AGD98704.1| bZIP transcription factor family protein 6 [Camellia sinensis] | Back alignment and taxonomy information |
|---|
| >gi|225451342|ref|XP_002279520.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|16797791|gb|AAL27150.1| bZIP transcription factor [Nicotiana tabacum] | Back alignment and taxonomy information |
|---|
| >gi|351720703|ref|NP_001237953.1| bZIP protein [Glycine max] gi|183014149|dbj|BAG24402.1| bZIP protein [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|147796457|emb|CAN74806.1| hypothetical protein VITISV_022136 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|351725229|ref|NP_001237085.1| bZIP transcription factor bZIP89 [Glycine max] gi|113367196|gb|ABI34655.1| bZIP transcription factor bZIP89 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|225437201|ref|XP_002281328.1| PREDICTED: light-inducible protein CPRF2-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449458456|ref|XP_004146963.1| PREDICTED: light-inducible protein CPRF2-like [Cucumis sativus] gi|449503812|ref|XP_004162189.1| PREDICTED: light-inducible protein CPRF2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 438 | ||||||
| TAIR|locus:505006398 | 403 | BZIP25 "basic leucine zipper 2 | 0.383 | 0.416 | 0.445 | 7.7e-48 | |
| TAIR|locus:2184251 | 314 | BZO2H3 "AT5G28770" [Arabidopsi | 0.248 | 0.347 | 0.522 | 1.4e-41 | |
| TAIR|locus:2149403 | 277 | BZIP9 "AT5G24800" [Arabidopsis | 0.232 | 0.368 | 0.409 | 1.8e-12 | |
| TAIR|locus:2053124 | 171 | bZIP2 "AT2G18160" [Arabidopsis | 0.289 | 0.742 | 0.255 | 5.6e-05 |
| TAIR|locus:505006398 BZIP25 "basic leucine zipper 25" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 339 (124.4 bits), Expect = 7.7e-48, Sum P(2) = 7.7e-48
Identities = 81/182 (44%), Positives = 107/182 (58%)
Query: 219 DSVDDKRARRMLXXXXXXXXXXXXKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYDES 278
D D KRARRML KQ +NE +TQ GQLRAEHS+L+ L+D+N KYD +
Sbjct: 226 DPTDVKRARRMLSNRESARRSRRRKQEQMNEFDTQVGQLRAEHSTLINRLSDMNHKYDAA 285
Query: 279 AVNNRILKADIETLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNAT 338
AV+NRIL+ADIETLR KVKMAEETVKRVTG+NPL +R P +G+P N P +A+
Sbjct: 286 AVDNRILRADIETLRTKVKMAEETVKRVTGVNPLHWSR---PNMGIPFSNTP-----SAS 337
Query: 339 HPMQPNPNQFFHQAIPSISTPT--PNHQSLDSS--FPSNIQLPTVGNPQSDRGGKNMTET 394
+ PN N A S +T +Q ++++ P + + NP + N+ ET
Sbjct: 338 SSIPPNSNHILKPANSSTNTSAGLAQNQRVETANFLPEQVNREGMQNPFAP--DSNLYET 395
Query: 395 SP 396
P
Sbjct: 396 LP 397
|
|
| TAIR|locus:2184251 BZO2H3 "AT5G28770" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149403 BZIP9 "AT5G24800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2053124 bZIP2 "AT2G18160" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 438 | |||
| pfam12498 | 112 | pfam12498, bZIP_C, Basic leucine-zipper C terminal | 2e-23 | |
| smart00338 | 65 | smart00338, BRLZ, basic region leucin zipper | 9e-16 | |
| pfam00170 | 64 | pfam00170, bZIP_1, bZIP transcription factor | 2e-11 | |
| cd12193 | 54 | cd12193, B_zip1, basic leucine zipper DNA-binding | 2e-06 | |
| pfam07716 | 54 | pfam07716, bZIP_2, Basic region leucine zipper | 3e-06 | |
| TIGR02169 | 1164 | TIGR02169, SMC_prok_A, chromosome segregation prot | 0.002 | |
| TIGR04211 | 198 | TIGR04211, SH3_and_anchor, SH3 domain protein | 0.004 |
| >gnl|CDD|221605 pfam12498, bZIP_C, Basic leucine-zipper C terminal | Back alignment and domain information |
|---|
Score = 94.1 bits (234), Expect = 2e-23
Identities = 49/128 (38%), Positives = 64/128 (50%), Gaps = 16/128 (12%)
Query: 291 TLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFH 350
TLRAKVKMAE+TVKRVTGLNPLL A S++ +GMP P DAS +A+ P+Q N + +F
Sbjct: 1 TLRAKVKMAEDTVKRVTGLNPLLQAISEMSSMGMPFSG-PSDASSDASVPIQDNSSNYFQ 59
Query: 351 QAIPSISTPTPNHQSLDSSFPSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGV 410
Q + + Q + T G M T LQ LEH+ + +
Sbjct: 60 QPAVNPGITVHDDQPE-------LGGATAGGK--------MGRTPSLQRVASLEHLQKRI 104
Query: 411 GHRVSPPG 418
VS
Sbjct: 105 RGGVSSST 112
|
This family of proteins is found in eukaryotes. Proteins in this family are typically between 174 and 411 amino acids in length. The family is found in association with pfam00170. There is a conserved KVK sequence motif. There is a single completely conserved residue K that may be functionally important. Various bZIP proteins have been found and shown to play a role in seed-specific gene expression. bZIP binds to the alpha-globulin gene promoter, but not to promoters of other major storage genes such as glutelin, prolamin and albumin. Length = 112 |
| >gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper | Back alignment and domain information |
|---|
| >gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor | Back alignment and domain information |
|---|
| >gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper | Back alignment and domain information |
|---|
| >gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type | Back alignment and domain information |
|---|
| >gnl|CDD|234501 TIGR04211, SH3_and_anchor, SH3 domain protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 438 | |||
| PF12498 | 115 | bZIP_C: Basic leucine-zipper C terminal; InterPro: | 99.94 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 99.31 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 99.27 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 99.26 | |
| KOG4343 | 655 | consensus bZIP transcription factor ATF6 [Transcri | 99.16 | |
| KOG3584 | 348 | consensus cAMP response element binding protein an | 99.0 | |
| PF07716 | 54 | bZIP_2: Basic region leucine zipper; InterPro: IPR | 98.97 | |
| KOG0709 | 472 | consensus CREB/ATF family transcription factor [Tr | 98.95 | |
| PF03131 | 92 | bZIP_Maf: bZIP Maf transcription factor; InterPro: | 98.02 | |
| KOG0837 | 279 | consensus Transcriptional activator of the JUN fam | 97.91 | |
| KOG4571 | 294 | consensus Activating transcription factor 4 [Trans | 97.11 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 97.1 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 96.77 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 96.6 | |
| KOG3863 | 604 | consensus bZIP transcription factor NRF1 [Transcri | 96.4 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 96.07 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 95.75 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 95.7 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 95.49 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 95.41 | |
| PF07989 | 75 | Microtub_assoc: Microtubule associated; InterPro: | 95.35 | |
| TIGR02449 | 65 | conserved hypothetical protein TIGR02449. Members | 94.95 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 94.78 | |
| PF06005 | 72 | DUF904: Protein of unknown function (DUF904); Inte | 94.74 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 94.58 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 94.5 | |
| PRK13729 | 475 | conjugal transfer pilus assembly protein TraB; Pro | 94.42 | |
| PF06156 | 107 | DUF972: Protein of unknown function (DUF972); Inte | 94.35 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 94.28 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 94.25 | |
| PRK13169 | 110 | DNA replication intiation control protein YabA; Re | 94.0 | |
| PRK11637 | 428 | AmiB activator; Provisional | 93.72 | |
| PRK10884 | 206 | SH3 domain-containing protein; Provisional | 93.7 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 93.62 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.61 | |
| PF04899 | 70 | MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 Th | 93.41 | |
| PF11559 | 151 | ADIP: Afadin- and alpha -actinin-Binding; InterPro | 93.34 | |
| PF08614 | 194 | ATG16: Autophagy protein 16 (ATG16); InterPro: IPR | 92.95 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 92.54 | |
| PRK15422 | 79 | septal ring assembly protein ZapB; Provisional | 92.46 | |
| PF13851 | 201 | GAS: Growth-arrest specific micro-tubule binding | 91.97 | |
| PRK11637 | 428 | AmiB activator; Provisional | 91.95 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 91.46 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 91.0 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 90.85 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 90.75 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 90.72 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 90.61 | |
| PF13747 | 89 | DUF4164: Domain of unknown function (DUF4164) | 90.29 | |
| KOG4005 | 292 | consensus Transcription factor XBP-1 [Transcriptio | 90.26 | |
| PF02403 | 108 | Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom | 90.09 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 90.03 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 89.9 | |
| COG3883 | 265 | Uncharacterized protein conserved in bacteria [Fun | 89.8 | |
| PF10224 | 80 | DUF2205: Predicted coiled-coil protein (DUF2205); | 89.73 | |
| COG2433 | 652 | Uncharacterized conserved protein [Function unknow | 89.61 | |
| PF10186 | 302 | Atg14: UV radiation resistance protein and autopha | 89.53 | |
| COG4026 | 290 | Uncharacterized protein containing TOPRIM domain, | 89.47 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 89.43 | |
| PRK09039 | 343 | hypothetical protein; Validated | 89.43 | |
| PF11932 | 251 | DUF3450: Protein of unknown function (DUF3450); In | 89.32 | |
| PF04849 | 306 | HAP1_N: HAP1 N-terminal conserved region; InterPro | 89.08 | |
| PF02183 | 45 | HALZ: Homeobox associated leucine zipper; InterPro | 89.02 | |
| TIGR03495 | 135 | phage_LysB phage lysis regulatory protein, LysB fa | 88.77 | |
| PF07106 | 169 | TBPIP: Tat binding protein 1(TBP-1)-interacting pr | 88.76 | |
| PF07888 | 546 | CALCOCO1: Calcium binding and coiled-coil domain ( | 88.71 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 88.61 | |
| PF04880 | 166 | NUDE_C: NUDE protein, C-terminal conserved region; | 88.36 | |
| PF14197 | 69 | Cep57_CLD_2: Centrosome localisation domain of PPC | 88.31 | |
| PF15070 | 617 | GOLGA2L5: Putative golgin subfamily A member 2-lik | 88.05 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 87.94 | |
| PF12808 | 52 | Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 | 87.84 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 87.81 | |
| PF10805 | 106 | DUF2730: Protein of unknown function (DUF2730); In | 87.78 | |
| KOG1853 | 333 | consensus LIS1-interacting protein NUDE [Cytoskele | 87.36 | |
| PRK00888 | 105 | ftsB cell division protein FtsB; Reviewed | 87.18 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 87.14 | |
| PRK04406 | 75 | hypothetical protein; Provisional | 87.06 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 87.05 | |
| PF10473 | 140 | CENP-F_leu_zip: Leucine-rich repeats of kinetochor | 86.93 | |
| PF08647 | 96 | BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR01395 | 86.76 | |
| TIGR00219 | 283 | mreC rod shape-determining protein MreC. MreC (mur | 86.71 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 86.61 | |
| PF15035 | 182 | Rootletin: Ciliary rootlet component, centrosome c | 86.57 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 86.55 | |
| TIGR02894 | 161 | DNA_bind_RsfA transcription factor, RsfA family. I | 86.44 | |
| COG3074 | 79 | Uncharacterized protein conserved in bacteria [Fun | 86.22 | |
| COG4467 | 114 | Regulator of replication initiation timing [Replic | 86.2 | |
| PF14662 | 193 | CCDC155: Coiled-coil region of CCDC155 | 86.19 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 86.16 | |
| PF08317 | 325 | Spc7: Spc7 kinetochore protein; InterPro: IPR01325 | 86.05 | |
| PF12329 | 74 | TMF_DNA_bd: TATA element modulatory factor 1 DNA b | 85.89 | |
| PHA02562 | 562 | 46 endonuclease subunit; Provisional | 85.85 | |
| PRK09039 | 343 | hypothetical protein; Validated | 85.59 | |
| PF06785 | 401 | UPF0242: Uncharacterised protein family (UPF0242); | 85.35 | |
| PF09304 | 107 | Cortex-I_coil: Cortexillin I, coiled coil; InterPr | 85.24 | |
| PRK04325 | 74 | hypothetical protein; Provisional | 85.05 | |
| PF12711 | 86 | Kinesin-relat_1: Kinesin motor; InterPro: IPR02465 | 84.93 | |
| KOG3119 | 269 | consensus Basic region leucine zipper transcriptio | 84.76 | |
| PRK00846 | 77 | hypothetical protein; Provisional | 84.68 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 84.59 | |
| PF05266 | 190 | DUF724: Protein of unknown function (DUF724); Inte | 84.46 | |
| PF04156 | 191 | IncA: IncA protein; InterPro: IPR007285 Chlamydia | 84.36 | |
| PF12777 | 344 | MT: Microtubule-binding stalk of dynein motor; Int | 84.33 | |
| PF12325 | 120 | TMF_TATA_bd: TATA element modulatory factor 1 TATA | 84.31 | |
| PRK02793 | 72 | phi X174 lysis protein; Provisional | 84.06 | |
| KOG1414 | 395 | consensus Transcriptional activator FOSB/c-Fos and | 84.01 | |
| KOG0982 | 502 | consensus Centrosomal protein Nuf [Cell cycle cont | 83.74 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 83.6 | |
| PF15294 | 278 | Leu_zip: Leucine zipper | 83.56 | |
| PF09755 | 310 | DUF2046: Uncharacterized conserved protein H4 (DUF | 83.54 | |
| PF11180 | 192 | DUF2968: Protein of unknown function (DUF2968); In | 83.3 | |
| PF12718 | 143 | Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 | 83.26 | |
| PF10226 | 195 | DUF2216: Uncharacterized conserved proteins (DUF22 | 83.25 | |
| smart00338 | 65 | BRLZ basic region leucin zipper. | 83.02 | |
| PF04102 | 69 | SlyX: SlyX; InterPro: IPR007236 The SlyX protein h | 82.94 | |
| smart00340 | 44 | HALZ homeobox associated leucin zipper. | 82.9 | |
| PRK02119 | 73 | hypothetical protein; Provisional | 82.81 | |
| KOG4196 | 135 | consensus bZIP transcription factor MafK [Transcri | 82.8 | |
| PF07407 | 420 | Seadorna_VP6: Seadornavirus VP6 protein; InterPro: | 82.79 | |
| PRK00295 | 68 | hypothetical protein; Provisional | 82.54 | |
| PF00170 | 64 | bZIP_1: bZIP transcription factor cAMP response el | 82.53 | |
| COG4942 | 420 | Membrane-bound metallopeptidase [Cell division and | 82.51 | |
| PF06632 | 342 | XRCC4: DNA double-strand break repair and V(D)J re | 82.11 | |
| PF10481 | 307 | CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 | 82.02 | |
| PF05667 | 594 | DUF812: Protein of unknown function (DUF812); Inte | 81.97 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 81.86 | |
| PF09728 | 309 | Taxilin: Myosin-like coiled-coil protein; InterPro | 81.56 | |
| PF04977 | 80 | DivIC: Septum formation initiator; InterPro: IPR00 | 81.54 | |
| PRK05431 | 425 | seryl-tRNA synthetase; Provisional | 81.51 | |
| PF06810 | 155 | Phage_GP20: Phage minor structural protein GP20; I | 81.43 | |
| TIGR03752 | 472 | conj_TIGR03752 integrating conjugative element pro | 81.39 | |
| TIGR01843 | 423 | type_I_hlyD type I secretion membrane fusion prote | 81.38 | |
| KOG0250 | 1074 | consensus DNA repair protein RAD18 (SMC family pro | 81.36 | |
| PF07412 | 200 | Geminin: Geminin; InterPro: IPR022786 This family | 81.34 | |
| PF09738 | 302 | DUF2051: Double stranded RNA binding protein (DUF2 | 81.26 | |
| PF04111 | 314 | APG6: Autophagy protein Apg6; InterPro: IPR007243 | 81.14 | |
| PRK13922 | 276 | rod shape-determining protein MreC; Provisional | 81.11 | |
| PF08826 | 61 | DMPK_coil: DMPK coiled coil domain like; InterPro: | 80.97 | |
| PF05837 | 106 | CENP-H: Centromere protein H (CENP-H); InterPro: I | 80.94 | |
| KOG0288 | 459 | consensus WD40 repeat protein TipD [General functi | 80.92 | |
| KOG0977 | 546 | consensus Nuclear envelope protein lamin, intermed | 80.81 | |
| KOG4403 | 575 | consensus Cell surface glycoprotein STIM, contains | 80.67 | |
| PHA03162 | 135 | hypothetical protein; Provisional | 80.54 | |
| KOG2391 | 365 | consensus Vacuolar sorting protein/ubiquitin recep | 80.49 | |
| KOG1962 | 216 | consensus B-cell receptor-associated protein and r | 80.47 | |
| PF10211 | 189 | Ax_dynein_light: Axonemal dynein light chain; Inte | 80.32 | |
| PF14915 | 305 | CCDC144C: CCDC144C protein coiled-coil region | 80.27 | |
| PF09726 | 697 | Macoilin: Transmembrane protein; InterPro: IPR0191 | 80.24 | |
| COG1579 | 239 | Zn-ribbon protein, possibly nucleic acid-binding [ | 80.19 |
| >PF12498 bZIP_C: Basic leucine-zipper C terminal; InterPro: IPR020983 Basic leucine-zipper (bZIP) proteins are found in eukaryotes | Back alignment and domain information |
|---|
Probab=99.94 E-value=5.9e-28 Score=210.66 Aligned_cols=114 Identities=39% Similarity=0.604 Sum_probs=98.0
Q ss_pred HHHHHHHHHHHHHHHHhccchhhhhccCCCCCCCCCCCCCCccCcCCCCCCCCCCCccccccCCCCCCCCCCCCCCCCCC
Q 013689 291 TLRAKVKMAEETVKRVTGLNPLLLARSDVPGVGMPLVNVPLDASRNATHPMQPNPNQFFHQAIPSISTPTPNHQSLDSSF 370 (438)
Q Consensus 291 ~Lrakl~maE~~v~Rl~~ln~~l~~~~~~~~~~~p~~~~~~~~s~~~~vp~q~~~~~~~~~~~~~~~~~~~~~~~~~n~~ 370 (438)
+||+|||||||+|||++|+|++|+.+.++++++|||.++++|+.+++++|+|+++.|||+++.++.+++..+ |.
T Consensus 1 TLRAKVKMAEe~VkRvTg~n~~~~~~~~~ss~~~p~~~~~s~~~~~~~~Piq~~~~~~~~~~~~~~~i~~~~-----~~- 74 (115)
T PF12498_consen 1 TLRAKVKMAEETVKRVTGMNPMFQAISQMSSMGMPFSSSPSPADSSAAVPIQDNSNNYFHQPNPNPTISVHG-----NN- 74 (115)
T ss_pred ChhHHHHHHHHHHHHHhccCccccccccCCCCCCCCCCCcccccccccCCccCCchhhccCCCCCCCcCCCC-----cc-
Confidence 599999999999999999999999999999999999999898887899999999999999988888877422 11
Q ss_pred CCCCCCCCCCCCCCCCCCCCCCCCCcccccccccccccccCCccCCC
Q 013689 371 PSNIQLPTVGNPQSDRGGKNMTETSPLQHAVGLEHVPQGVGHRVSPP 417 (438)
Q Consensus 371 ~~~~~~p~~~~~q~~~~~~~m~~~~s~q~vaslehlqkr~~~~~~~~ 417 (438)
+.+. .+...++.||+|+++|||||||||||||||+|+++|
T Consensus 75 ----~~~~---~~~~~~~~~~~~t~smqrvaslEhlQkri~~g~~~~ 114 (115)
T PF12498_consen 75 ----DNPE---PGGAFVGGKMGRTASMQRVASLEHLQKRIRGGPTSS 114 (115)
T ss_pred ----cccc---cccccccccccCCccCccchhHHHHHHHhcCCCCCC
Confidence 1221 122357889999999999999999999999998765
|
They are typically between 174 and 411 amino acids in length. Various bZIP proteins have been found and shown to play a role in seed-specific gene expression. bZIP binds to the alpha-globulin gene promoter, but not to promoters of other major storage genes such as glutelin, prolamin and albumin []. This entry represents a C-terminal domain found in bZIP proteins. It is found in association with PF00170 from PFAM. There is a conserved KVK sequence motif and a single completely conserved residue K that may be functionally important. |
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >KOG4343 consensus bZIP transcription factor ATF6 [Transcription] | Back alignment and domain information |
|---|
| >KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] | Back alignment and domain information |
|---|
| >PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization | Back alignment and domain information |
|---|
| >KOG0709 consensus CREB/ATF family transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell | Back alignment and domain information |
|---|
| >KOG0837 consensus Transcriptional activator of the JUN family [Transcription] | Back alignment and domain information |
|---|
| >KOG4571 consensus Activating transcription factor 4 [Transcription] | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >KOG3863 consensus bZIP transcription factor NRF1 [Transcription] | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >PF07989 Microtub_assoc: Microtubule associated; InterPro: IPR012943 Proteins with this domain associate with the spindle body during cell division [] | Back alignment and domain information |
|---|
| >TIGR02449 conserved hypothetical protein TIGR02449 | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK13729 conjugal transfer pilus assembly protein TraB; Provisional | Back alignment and domain information |
|---|
| >PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK13169 DNA replication intiation control protein YabA; Reviewed | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PRK10884 SH3 domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF04899 MbeD_MobD: MbeD/MobD like ; InterPro: IPR006983 The MbeD and MobD proteins are plasmid encoded, and are involved in the plasmid mobilisation and transfer in the presence of conjugative plasmids [] | Back alignment and domain information |
|---|
| >PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch | Back alignment and domain information |
|---|
| >PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PRK15422 septal ring assembly protein ZapB; Provisional | Back alignment and domain information |
|---|
| >PF13851 GAS: Growth-arrest specific micro-tubule binding | Back alignment and domain information |
|---|
| >PRK11637 AmiB activator; Provisional | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF13747 DUF4164: Domain of unknown function (DUF4164) | Back alignment and domain information |
|---|
| >KOG4005 consensus Transcription factor XBP-1 [Transcription] | Back alignment and domain information |
|---|
| >PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >COG3883 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure | Back alignment and domain information |
|---|
| >COG2433 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF10186 Atg14: UV radiation resistance protein and autophagy-related subunit 14; InterPro: IPR018791 Class III phosphatidylinositol 3-kinase (PI3-kinase) regulates multiple membrane trafficking | Back alignment and domain information |
|---|
| >COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function | Back alignment and domain information |
|---|
| >PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues | Back alignment and domain information |
|---|
| >PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] | Back alignment and domain information |
|---|
| >TIGR03495 phage_LysB phage lysis regulatory protein, LysB family | Back alignment and domain information |
|---|
| >PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences | Back alignment and domain information |
|---|
| >PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins | Back alignment and domain information |
|---|
| >PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 | Back alignment and domain information |
|---|
| >PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins | Back alignment and domain information |
|---|
| >KOG1853 consensus LIS1-interacting protein NUDE [Cytoskeleton] | Back alignment and domain information |
|---|
| >PRK00888 ftsB cell division protein FtsB; Reviewed | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK04406 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] | Back alignment and domain information |
|---|
| >PF08647 BRE1: BRE1 E3 ubiquitin ligase; InterPro: IPR013956 BRE1 is an E3 ubiquitin ligase that has been shown to act as a transcriptional activator through direct activator interactions [] | Back alignment and domain information |
|---|
| >TIGR00219 mreC rod shape-determining protein MreC | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF15035 Rootletin: Ciliary rootlet component, centrosome cohesion | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02894 DNA_bind_RsfA transcription factor, RsfA family | Back alignment and domain information |
|---|
| >COG3074 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF14662 CCDC155: Coiled-coil region of CCDC155 | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] | Back alignment and domain information |
|---|
| >PF12329 TMF_DNA_bd: TATA element modulatory factor 1 DNA binding; InterPro: IPR022092 This is the middle region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes that contains at its N-terminal section a number of leucine zippers that could potentially form coiled coil structures | Back alignment and domain information |
|---|
| >PHA02562 46 endonuclease subunit; Provisional | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF06785 UPF0242: Uncharacterised protein family (UPF0242); InterPro: IPR009623 This is a group of proteins of unknown function | Back alignment and domain information |
|---|
| >PF09304 Cortex-I_coil: Cortexillin I, coiled coil; InterPro: IPR015383 This domain is predominantly found in the actin-bundling protein cortexillin I from Dictyostelium discoideum (Slime mold) | Back alignment and domain information |
|---|
| >PRK04325 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12711 Kinesin-relat_1: Kinesin motor; InterPro: IPR024658 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport | Back alignment and domain information |
|---|
| >KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] | Back alignment and domain information |
|---|
| >PRK00846 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana | Back alignment and domain information |
|---|
| >PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion | Back alignment and domain information |
|---|
| >PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] | Back alignment and domain information |
|---|
| >PRK02793 phi X174 lysis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] | Back alignment and domain information |
|---|
| >KOG0982 consensus Centrosomal protein Nuf [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF15294 Leu_zip: Leucine zipper | Back alignment and domain information |
|---|
| >PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain | Back alignment and domain information |
|---|
| >PF11180 DUF2968: Protein of unknown function (DUF2968); InterPro: IPR021350 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells | Back alignment and domain information |
|---|
| >PF10226 DUF2216: Uncharacterized conserved proteins (DUF2216); InterPro: IPR019359 Proteins in this entry are found in Metazoa and contain a coiled-coil domain | Back alignment and domain information |
|---|
| >smart00338 BRLZ basic region leucin zipper | Back alignment and domain information |
|---|
| >PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function | Back alignment and domain information |
|---|
| >smart00340 HALZ homeobox associated leucin zipper | Back alignment and domain information |
|---|
| >PRK02119 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4196 consensus bZIP transcription factor MafK [Transcription] | Back alignment and domain information |
|---|
| >PF07407 Seadorna_VP6: Seadornavirus VP6 protein; InterPro: IPR009982 This family consists of several VP6 proteins from the Banna virus as well as a related protein VP5 from the Kadipiro virus | Back alignment and domain information |
|---|
| >PRK00295 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization | Back alignment and domain information |
|---|
| >COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF06632 XRCC4: DNA double-strand break repair and V(D)J recombination protein XRCC4; InterPro: IPR010585 This entry represents the DNA double-strand break repair and V(D)J recombination protein XRCC4, which is found in certain Metazoans, fungi and plants | Back alignment and domain information |
|---|
| >PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] | Back alignment and domain information |
|---|
| >PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed | Back alignment and domain information |
|---|
| >PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] | Back alignment and domain information |
|---|
| >PRK05431 seryl-tRNA synthetase; Provisional | Back alignment and domain information |
|---|
| >PF06810 Phage_GP20: Phage minor structural protein GP20; InterPro: IPR009636 This family consists of several phage minor structural protein Gp20 sequences and prophage sequences of around 180 residues in length | Back alignment and domain information |
|---|
| >TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family | Back alignment and domain information |
|---|
| >TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family | Back alignment and domain information |
|---|
| >KOG0250 consensus DNA repair protein RAD18 (SMC family protein) [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >PF07412 Geminin: Geminin; InterPro: IPR022786 This family contains the eukaryotic protein geminin (approximately 200 residues long) | Back alignment and domain information |
|---|
| >PF09738 DUF2051: Double stranded RNA binding protein (DUF2051); InterPro: IPR019139 This entry represents transcriptional repressors which preferentially bind to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA | Back alignment and domain information |
|---|
| >PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells | Back alignment and domain information |
|---|
| >PRK13922 rod shape-determining protein MreC; Provisional | Back alignment and domain information |
|---|
| >PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure | Back alignment and domain information |
|---|
| >PF05837 CENP-H: Centromere protein H (CENP-H); InterPro: IPR008426 Chromosome segregation in eukaryotes requires the kinetochore, a multi-protein structure that assembles on centromeric DNA, and which acts to link chromosomes to spindle microtubules | Back alignment and domain information |
|---|
| >KOG0288 consensus WD40 repeat protein TipD [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] | Back alignment and domain information |
|---|
| >KOG4403 consensus Cell surface glycoprotein STIM, contains SAM domain [General function prediction only] | Back alignment and domain information |
|---|
| >PHA03162 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2391 consensus Vacuolar sorting protein/ubiquitin receptor VPS23 [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1962 consensus B-cell receptor-associated protein and related proteins [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF10211 Ax_dynein_light: Axonemal dynein light chain; InterPro: IPR019347 Axonemal dynein light chain proteins play a dynamic role in flagellar and cilial motility | Back alignment and domain information |
|---|
| >PF14915 CCDC144C: CCDC144C protein coiled-coil region | Back alignment and domain information |
|---|
| >PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes | Back alignment and domain information |
|---|
| >COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 438 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 3e-14 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 2e-10 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 5e-09 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 1e-08 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 2e-08 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 2e-08 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 6e-08 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 1e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 4e-07 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 2e-05 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 5e-04 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 | Back alignment and structure |
|---|
Score = 66.3 bits (162), Expect = 3e-14
Identities = 18/52 (34%), Positives = 32/52 (61%)
Query: 224 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKY 275
KR R++ NRE+AR SRR+K+ ++ LE + L ++ +L++ L + Y
Sbjct: 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLY 52
|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 438 | |||
| 1dh3_A | 55 | Transcription factor CREB; protein-DNA complex, tr | 99.5 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 99.25 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 99.19 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 99.14 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 99.05 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 98.88 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 98.85 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 98.46 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 98.44 | |
| 3a5t_A | 107 | Transcription factor MAFG; protein-DNA complex, BZ | 98.37 | |
| 2wt7_B | 90 | Transcription factor MAFB; transcription, transcri | 98.09 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 97.03 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 95.72 | |
| 1skn_P | 92 | DNA-binding domain of SKN-1; complex (transcriptio | 95.49 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 95.44 | |
| 1deb_A | 54 | APC protein, adenomatous polyposis coli protein; c | 94.69 | |
| 2jee_A | 81 | YIIU; FTSZ, septum, coiled-coil, cell division, ce | 94.58 | |
| 2w6a_A | 63 | ARF GTPase-activating protein GIT1; PIX, zinc, sig | 93.81 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 93.63 | |
| 1wlq_A | 83 | Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2z | 93.23 | |
| 3hnw_A | 138 | Uncharacterized protein; coiled-coil, structural g | 92.49 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 92.19 | |
| 1go4_E | 100 | MAD1 (mitotic arrest deficient)-like 1; mitotic sp | 92.06 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 91.39 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 91.13 | |
| 3u1c_A | 101 | Tropomyosin alpha-1 chain; anti-parallel coiled co | 91.06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 90.58 | |
| 3u59_A | 101 | Tropomyosin beta chain; muscle contraction, actin, | 90.01 | |
| 1hjb_A | 87 | Ccaat/enhancer binding protein beta; transcription | 89.87 | |
| 1ci6_A | 63 | Transcription factor ATF-4; BZIP; 2.60A {Homo sapi | 89.62 | |
| 2wt7_A | 63 | Proto-oncogene protein C-FOS; transcription, trans | 89.49 | |
| 1ic2_A | 81 | Tropomyosin alpha chain, skeletal muscle; alpha-he | 89.25 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 89.22 | |
| 1t2k_D | 61 | Cyclic-AMP-dependent transcription factor ATF-2; p | 89.12 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.93 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 88.9 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 88.89 | |
| 3o0z_A | 168 | RHO-associated protein kinase 1; coiled-coil, tran | 88.77 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 88.57 | |
| 2c9l_Y | 63 | EB1, zebra, BZLF1 trans-activator protein; viral p | 88.04 | |
| 3m9b_A | 251 | Proteasome-associated ATPase; coil COIL with 5 bet | 88.02 | |
| 3a7p_A | 152 | Autophagy protein 16; coiled-coil, coiled coil, cy | 87.89 | |
| 3cve_A | 72 | Homer protein homolog 1; coiled coil, alternative | 87.89 | |
| 2v4h_A | 110 | NF-kappa-B essential modulator; transcription, met | 87.84 | |
| 2eqb_B | 97 | RAB guanine nucleotide exchange factor SEC2; coile | 87.76 | |
| 1p9i_A | 31 | Cortexillin I/GCN4 hybrid peptide; coiled-coil, un | 87.66 | |
| 2v71_A | 189 | Nuclear distribution protein NUDE-like 1; developm | 87.52 | |
| 1wle_A | 501 | Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bo | 87.5 | |
| 2wvr_A | 209 | Geminin; DNA replication license, DNA replication | 87.42 | |
| 1gd2_E | 70 | Transcription factor PAP1; basic leucine zipper, p | 87.15 | |
| 3m48_A | 33 | General control protein GCN4; leucine zipper, synt | 87.09 | |
| 3s9g_A | 104 | Protein hexim1; cyclin T-binding domain (TBD), cyc | 87.02 | |
| 1kd8_B | 36 | GABH BLL, GCN4 acid base heterodimer base-D12LA16L | 86.87 | |
| 3he5_A | 49 | Synzip1; heterodimeric coiled-coil, de novo protei | 86.86 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 86.79 | |
| 3cvf_A | 79 | Homer-3, homer protein homolog 3; coiled coil, alt | 86.61 | |
| 2zxx_A | 79 | Geminin; coiled-coil, cell cycle, coiled coil, DNA | 86.58 | |
| 3bas_A | 89 | Myosin heavy chain, striated muscle/general contro | 86.09 | |
| 2oxj_A | 34 | Hybrid alpha/beta peptide based on the GCN4-P1 Se | 85.97 | |
| 1gu4_A | 78 | CAAT/enhancer binding protein beta; transcription/ | 85.91 | |
| 3jsv_C | 94 | NF-kappa-B essential modulator; ubiquitin, coiled- | 85.68 | |
| 1ses_A | 421 | Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A | 85.2 | |
| 2dq0_A | 455 | Seryl-tRNA synthetase; coiled-coil, homodimer, str | 84.26 | |
| 3vmx_A | 48 | Voltage-gated hydrogen channel 1; coiled-coil, ION | 84.16 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 84.11 | |
| 1jnm_A | 62 | Proto-oncogene C-JUN; BZIP, protein-DNA complex, t | 83.71 | |
| 1kd8_A | 36 | GABH AIV, GCN4 acid base heterodimer acid-D12IA16V | 83.66 | |
| 2kz5_A | 91 | Transcription factor NF-E2 45 kDa subunit; structu | 83.41 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 83.34 | |
| 4h22_A | 103 | Leucine-rich repeat flightless-interacting protei; | 83.33 | |
| 2v66_B | 111 | Nuclear distribution protein NUDE-like 1; structur | 83.06 | |
| 2xdj_A | 83 | Uncharacterized protein YBGF; unknown function; 1. | 82.95 | |
| 3qne_A | 485 | Seryl-tRNA synthetase, cytoplasmic; amino acid bio | 82.39 | |
| 3c3f_A | 34 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 82.37 | |
| 3efg_A | 78 | Protein SLYX homolog; xanthomonas campestris PV. c | 82.23 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 82.2 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 81.89 | |
| 3a2a_A | 58 | Voltage-gated hydrogen channel 1; voltage-gated pr | 81.5 | |
| 3na7_A | 256 | HP0958; flagellar biogenesis, flagellum export, C4 | 81.3 | |
| 3iv1_A | 78 | Tumor susceptibility gene 101 protein; coiled_COIL | 80.96 | |
| 3c3g_A | 33 | Alpha/beta peptide with the GCN4-PLI SIDE chain S | 80.59 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 80.38 | |
| 3mq7_A | 121 | Bone marrow stromal antigen 2; HIV, antiviral prot | 80.28 | |
| 2dgc_A | 63 | Protein (GCN4); basic domain, leucine zipper, DNA | 80.26 | |
| 2oqq_A | 42 | Transcription factor HY5; homodimer leucine zipper | 80.21 | |
| 3ghg_A | 562 | Fibrinogen alpha chain; triple-stranded coiled coi | 80.13 | |
| 2hy6_A | 34 | General control protein GCN4; protein design, para | 80.11 |
| >1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 | Back alignment and structure |
|---|
Probab=99.50 E-value=2.6e-14 Score=109.35 Aligned_cols=53 Identities=34% Similarity=0.596 Sum_probs=49.7
Q ss_pred HHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 013689 224 KRARRMLSNRESARRSRRRKQAHLNELETQAGQLRAEHSSLLKGLTDVNQKYD 276 (438)
Q Consensus 224 KR~RR~lsNRESARRSR~RKq~~leeLE~qV~~Le~EN~~L~~el~~l~qk~~ 276 (438)
||++||++||+||++||+||++|+++||.+|..|+.||..|..++..|++.|.
T Consensus 1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~~L~~~~~ 53 (55)
T 1dh3_A 1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKDLYS 53 (55)
T ss_dssp CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTST
T ss_pred ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence 68999999999999999999999999999999999999999999998887653
|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 | Back alignment and structure |
|---|
| >2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} | Back alignment and structure |
|---|
| >2w6a_A ARF GTPase-activating protein GIT1; PIX, zinc, signaling protein, CAT-1, cytoplasm, ANK repeat, coiled-coil, zinc-finger, metal-binding; 1.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1wlq_A Geminin; coiled-coil; 2.80A {Mus musculus} PDB: 2zxx_A* | Back alignment and structure |
|---|
| >3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} | Back alignment and structure |
|---|
| >1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D | Back alignment and structure |
|---|
| >1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y | Back alignment and structure |
|---|
| >3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A | Back alignment and structure |
|---|
| >3a7p_A Autophagy protein 16; coiled-coil, coiled coil, cytoplasmic vesicle, protein transport, transport, vacuole; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cve_A Homer protein homolog 1; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, postsynaptic cell membrane, synapse; 1.75A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} | Back alignment and structure |
|---|
| >2eqb_B RAB guanine nucleotide exchange factor SEC2; coiled coil, endocytosis/exocytosis complex; 2.70A {Saccharomyces cerevisiae} SCOP: h.1.33.1 | Back alignment and structure |
|---|
| >1p9i_A Cortexillin I/GCN4 hybrid peptide; coiled-coil, unknown function; 1.17A {Synthetic} SCOP: h.1.10.1 | Back alignment and structure |
|---|
| >2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1wle_A Seryl-tRNA synthetase; ligase; HET: SRP; 1.65A {Bos taurus} | Back alignment and structure |
|---|
| >2wvr_A Geminin; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A | Back alignment and structure |
|---|
| >3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A | Back alignment and structure |
|---|
| >1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B | Back alignment and structure |
|---|
| >3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >3cvf_A Homer-3, homer protein homolog 3; coiled coil, alternative splicing, cell junction, cytoplasm, membrane, phosphoprotein, polymorphism; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2zxx_A Geminin; coiled-coil, cell cycle, coiled coil, DNA replication inhibitor, phosphoprotein, DNA-binding, nucleus, proto-oncogene; HET: DNA; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >3bas_A Myosin heavy chain, striated muscle/general control protein GCN4 chimera; alpha-helical coiled coil, disorder, salt links; 2.30A {Argopecten irradians} SCOP: h.1.26.1 PDB: 1nkn_A 3bat_A | Back alignment and structure |
|---|
| >2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* | Back alignment and structure |
|---|
| >1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A | Back alignment and structure |
|---|
| >3jsv_C NF-kappa-B essential modulator; ubiquitin, coiled-coil, cellular signaling, cytoplasm, isopeptide bond, nucleus, phosphoprotein, UBL conjugation; 2.70A {Mus musculus} PDB: 3f89_A 2zvo_B 2zvn_B | Back alignment and structure |
|---|
| >1ses_A Seryl-tRNA synthetase; ligase; HET: AHX AMP; 2.50A {Thermus thermophilus} SCOP: a.2.7.1 d.104.1.1 PDB: 1ser_A* 1set_A* 1sry_A | Back alignment and structure |
|---|
| >2dq0_A Seryl-tRNA synthetase; coiled-coil, homodimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: SSA; 2.60A {Pyrococcus horikoshii} PDB: 2dq1_A* 2dq2_A 2zr2_A* 2zr3_A | Back alignment and structure |
|---|
| >3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A | Back alignment and structure |
|---|
| >1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A | Back alignment and structure |
|---|
| >2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >4h22_A Leucine-rich repeat flightless-interacting protei; nucleic acid sensor, transcription; 2.89A {Homo sapiens} | Back alignment and structure |
|---|
| >2v66_B Nuclear distribution protein NUDE-like 1; structural protein, developmental protein, structural protei phosphorylation, transport, microtubule; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2xdj_A Uncharacterized protein YBGF; unknown function; 1.82A {Escherichia coli} PDB: 2wz7_A | Back alignment and structure |
|---|
| >3qne_A Seryl-tRNA synthetase, cytoplasmic; amino acid biosynthesis, CTG-clade, codon ambiguity, pathoge II aminoacyl-tRNA synthetase family; 2.00A {Candida albicans} PDB: 3qo7_A* 3qo8_A* 3qo5_A | Back alignment and structure |
|---|
| >3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 | Back alignment and structure |
|---|
| >3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3iv1_A Tumor susceptibility gene 101 protein; coiled_COIL, tumorigenesis, CELL_cycle regulation, alternative splicing, cell cycle, cell division; HET: MSE; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A | Back alignment and structure |
|---|
| >2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D | Back alignment and structure |
|---|
| >2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* | Back alignment and structure |
|---|
| >2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 438 | |||
| d1sknp_ | 74 | Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | 90.04 | |
| d1seta1 | 110 | Seryl-tRNA synthetase (SerRS) {Thermus thermophilu | 85.69 |
| >d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: A DNA-binding domain in eukaryotic transcription factors superfamily: A DNA-binding domain in eukaryotic transcription factors family: A DNA-binding domain in eukaryotic transcription factors domain: Skn-1 species: Caenorhabditis elegans [TaxId: 6239]
Probab=90.04 E-value=0.069 Score=41.26 Aligned_cols=28 Identities=25% Similarity=0.338 Sum_probs=24.1
Q ss_pred HHHHHHHHHHhHHHHHHHHHHHHHHHHH
Q 013689 222 DDKRARRMLSNRESARRSRRRKQAHLNE 249 (438)
Q Consensus 222 d~KR~RR~lsNRESARRSR~RKq~~lee 249 (438)
-.+-+||.=+|+.+|+++|+||....++
T Consensus 46 lirDIRRRGKNKvAAqnCRKRKld~~d~ 73 (74)
T d1sknp_ 46 LIRKIRRRGKNKVAARTCRQRRTDRHDK 73 (74)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTTT
T ss_pred HHHHHHHhcccHHHHHHHHHhhhhhhcc
Confidence 3677899999999999999999877654
|
| >d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} | Back information, alignment and structure |
|---|