Citrus Sinensis ID: 013728

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------
MEFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQPHQCST
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHcccccccccccccEEEEEcccHHHHccccccccEEEccHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHHHcccccccccccEEcEEEEEccEEEccccEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccEEEEEcccccccccccccccccccEEEEEccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHccHEEEEEcccccEEEEEcHHHHHHHHccHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccHHHHHHcHHHHHHHHHHHHcccccccccHEEEccEEEccEEEccccEEEEEcEHcccccccccccccccHHHcccccccccEEEEcccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccEEEEEEccccc
MEFTIFSLCIAFALLFVFFYPLIITVKLkekiypnphlppgnlgwpvigeTLGFiragfegkpeRFIRERMEKYDSRVFKTCLLGEDMIVFCGTaghkllfsnenklvrtwwpssvgkLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGvmsfpvnfpgttfyksIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAeskeqgellkWEDIQKMKYTWNVASevmrlsppaiGAFREALVDftysgytipkgwklhwstgsthkdetlfpnpetfdasrferegatpysyvpfgggprmcpgyeFERLLILVFIHNMIKRfkwdllipdekfgydpmlspsqglpirlqphqcst
MEFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWpssvgklfktcLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREalgskqdllSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAeskeqgellkwEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSpsqglpirlqphqcst
MEFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKrmrrmmmmSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQPHQCST
**FTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGST********************EGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYD********************
MEFTIFSLCIAFALLFVFFYPLIITVKLKEK******LPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIK******************RLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQI************KWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPI**QPH****
MEFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQPHQCST
*EFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQPH****
iiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQPHQCST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query437 2.2.26 [Sep-21-2011]
Q50EK0497 Cytochrome P450 716B2 OS= N/A no 0.970 0.853 0.464 1e-120
Q50EK1493 Cytochrome P450 716B1 OS= N/A no 0.970 0.860 0.460 1e-120
Q8W4T9485 Taxane 13-alpha-hydroxyla N/A no 0.963 0.868 0.377 1e-88
Q6WG30499 Taxadiene 5-alpha hydroxy N/A no 0.922 0.807 0.368 5e-81
Q84KI1509 Taxoid 14-beta-hydroxylas N/A no 0.933 0.801 0.344 1e-76
Q6JTJ0500 Taxoid 7-beta-hydroxylase N/A no 0.922 0.806 0.354 5e-75
Q9AXM6497 Taxane 10-beta-hydroxylas N/A no 0.899 0.790 0.368 4e-71
Q9FH76463 Abscisic acid 8'-hydroxyl no no 0.954 0.900 0.308 4e-60
Q949P1467 Abscisic acid 8'-hydroxyl no no 0.933 0.873 0.303 2e-58
O81077482 Abscisic acid 8'-hydroxyl no no 0.885 0.802 0.315 4e-56
>sp|Q50EK0|C16B2_PICSI Cytochrome P450 716B2 OS=Picea sitchensis GN=CYP716B2 PE=2 SV=1 Back     alignment and function desciption
 Score =  431 bits (1108), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 222/478 (46%), Positives = 303/478 (63%), Gaps = 54/478 (11%)

Query: 5   IFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFEGKPE 64
           +F++ +A  +   FF+ LI   + K        +PPG  GWP+IGETL F+    +G P 
Sbjct: 22  MFTVFLASFIGLAFFFYLISNHRTKAW----RGIPPGTFGWPLIGETLEFLGCQRKGNPR 77

Query: 65  RFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLFKTCL 124
            F   R +KY + VF T L+G   +VFC   G++ LFSNENKLV   WPSSVG LF++ L
Sbjct: 78  DFFDSRTQKYGN-VFTTSLVGHPTVVFCSPEGNRFLFSNENKLVVNSWPSSVGNLFRSSL 136

Query: 125 LMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYW---------------- 168
           +   GDDAKR+RR++M +FL P AL ++V R+D +T++H+A +W                
Sbjct: 137 ITTVGDDAKRLRRILM-TFLRPEALREFVGRVDSMTKRHLAEHWIGKDEVTALPLLKRYT 195

Query: 169 ----------------------------EGVMSFPVNFPGTTFYKSIRAADAIREELIKL 200
                                       +GVM  P++ PGT + K+  AA+AIR++L  +
Sbjct: 196 FSLACDLFASINNKDDLGRLWLHFMVFVKGVMQIPIDLPGTRYNKAKHAANAIRQQLGSI 255

Query: 201 IAKQT--REALGS--KQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITL 256
           I ++    EA  +  +QDLLS L+   D  G+ LT+ E+ DNILLLL++ HDTSSS +T+
Sbjct: 256 INERKIGLEAGNASPEQDLLSFLLSNVDEQGESLTDNEIQDNILLLLYAGHDTSSSTLTV 315

Query: 257 LLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGA 316
           LLK+L + P  +E VLREQ+ IA SKE G+LL+WED+Q+MKY+W VA E +RL P A G+
Sbjct: 316 LLKFLAENPHCYEEVLREQLDIAGSKEAGQLLEWEDLQRMKYSWRVAQEALRLFPAAQGS 375

Query: 317 FREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFG 376
           FR+A+ +F Y G+TIPKGWK++W+  STH+    F NPETFD SRFE EG  PY++VPFG
Sbjct: 376 FRKAIKEFIYDGFTIPKGWKMYWTVNSTHRKSEYFSNPETFDPSRFEGEGPPPYTFVPFG 435

Query: 377 GGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQPHQ 434
           GGPRMCPG EF RL ILVF+HN++K  KW+L+ P EK   DPM +P  GLPI+L PH 
Sbjct: 436 GGPRMCPGNEFARLEILVFLHNIVKNCKWNLVNPGEKVIVDPMPAPVNGLPIKLVPHD 493

Picea sitchensis (taxid: 3332)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q50EK1|C16B1_PICSI Cytochrome P450 716B1 OS=Picea sitchensis GN=CYP716B1 PE=2 SV=1 Back     alignment and function description
>sp|Q8W4T9|T13H_TAXCU Taxane 13-alpha-hydroxylase OS=Taxus cuspidata GN=CYP725A2 PE=1 SV=1 Back     alignment and function description
>sp|Q6WG30|T5H_TAXCU Taxadiene 5-alpha hydroxylase OS=Taxus cuspidata PE=1 SV=2 Back     alignment and function description
>sp|Q84KI1|T14H_TAXCU Taxoid 14-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 Back     alignment and function description
>sp|Q6JTJ0|T7H_TAXCU Taxoid 7-beta-hydroxylase OS=Taxus cuspidata PE=1 SV=1 Back     alignment and function description
>sp|Q9AXM6|T10H_TAXCU Taxane 10-beta-hydroxylase OS=Taxus cuspidata GN=CYP725A1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FH76|ABAH3_ARATH Abscisic acid 8'-hydroxylase 3 OS=Arabidopsis thaliana GN=CYP707A3 PE=1 SV=1 Back     alignment and function description
>sp|Q949P1|ABAH1_ARATH Abscisic acid 8'-hydroxylase 1 OS=Arabidopsis thaliana GN=CYP707A1 PE=2 SV=1 Back     alignment and function description
>sp|O81077|ABAH2_ARATH Abscisic acid 8'-hydroxylase 2 OS=Arabidopsis thaliana GN=CYP707A2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
359478809473 PREDICTED: LOW QUALITY PROTEIN: cytochro 0.970 0.896 0.568 1e-153
356511023486 PREDICTED: cytochrome P450 716B2-like [G 0.986 0.886 0.548 1e-148
356528398481 PREDICTED: cytochrome P450 716B2-like [G 0.970 0.881 0.540 1e-146
356525339481 PREDICTED: cytochrome P450 716B2-like is 0.981 0.891 0.536 1e-145
357519279 948 Cytochrome P450 [Medicago truncatula] gi 0.979 0.451 0.540 1e-143
255564830455 cytochrome P450, putative [Ricinus commu 0.924 0.887 0.537 1e-142
224056935483 cytochrome P450 [Populus trichocarpa] gi 0.967 0.875 0.519 1e-141
86279654480 putative taxane 13-alpha-hydroxylase cyt 0.961 0.875 0.510 1e-133
297736038506 unnamed protein product [Vitis vinifera] 0.906 0.782 0.542 1e-132
147789083393 hypothetical protein VITISV_041016 [Viti 0.887 0.987 0.561 1e-131
>gi|359478809|ref|XP_003632173.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 716B2-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 274/482 (56%), Positives = 343/482 (71%), Gaps = 58/482 (12%)

Query: 1   MEFTIFSLCIAFALLFVFFYPLIITVKLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGFE 60
           MEF + +     A++   F    I   LK   + N  LPPG+LGWP IGETL F+R+G +
Sbjct: 1   MEFALIA-----AVILALFSLHFIAKILKAGKFSN--LPPGSLGWPRIGETLVFLRSGED 53

Query: 61  GKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKLF 120
           G+P+RFIRERM+KYDS VFKT LLGE M+VFCG AG+K LF NENKLV  WWPSSV KLF
Sbjct: 54  GEPQRFIRERMDKYDSGVFKTSLLGEPMMVFCGPAGNKFLFGNENKLVSVWWPSSVRKLF 113

Query: 121 KTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEG---------- 170
           ++CL+   GD+AKRMRRM++ +FL+P+AL +YVE +D++TQ HI T WEG          
Sbjct: 114 RSCLVTATGDEAKRMRRMLL-TFLNPDALKRYVETMDLVTQHHIRTQWEGNEEMQVYPII 172

Query: 171 ----------------------------------VMSFPVNFPGTTFYKSIRAADAIREE 196
                                             ++ FP+NFPGT F  + +AA+AIREE
Sbjct: 173 KLYTFELACRLFASMDDPGHISKLAAHFNVFLKGIIDFPINFPGTKFXYATKAANAIREE 232

Query: 197 LIKLIAKQTREALGSK-----QDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSS 251
           L +++  + R AL  K     QDLLS L+V AD++G+FLTEME+ DNILLLLF+ HDT++
Sbjct: 233 L-RVMPMERRVALEEKTASATQDLLSHLLVTADASGRFLTEMEIIDNILLLLFAGHDTTA 291

Query: 252 SAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSP 311
           SAITLL+KYLG++P+V+  VLRE+I I ESKE GELL+W+D QKM+Y+W+VASEVMRLSP
Sbjct: 292 SAITLLIKYLGELPEVYAKVLREKIDITESKEPGELLQWKDXQKMRYSWHVASEVMRLSP 351

Query: 312 PAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYS 371
           PA G+FREALVDF+Y+GY IPKGWKL+W TGST +D   F NP+ FDASRFE  G  P+S
Sbjct: 352 PASGSFREALVDFSYAGYNIPKGWKLYWGTGSTQRDPAFFRNPDNFDASRFEGAGPAPFS 411

Query: 372 YVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRLQ 431
           YVPFGGGPRMC G EF RL ILVF+HN++KRF WDLL PDEK  + PML+P +GLPIRL 
Sbjct: 412 YVPFGGGPRMCLGQEFARLQILVFMHNIVKRFTWDLLNPDEKIEHSPMLAPLEGLPIRLH 471

Query: 432 PH 433
           PH
Sbjct: 472 PH 473

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356511023|ref|XP_003524231.1| PREDICTED: cytochrome P450 716B2-like [Glycine max] Back     alignment and taxonomy information
>gi|356528398|ref|XP_003532790.1| PREDICTED: cytochrome P450 716B2-like [Glycine max] Back     alignment and taxonomy information
>gi|356525339|ref|XP_003531282.1| PREDICTED: cytochrome P450 716B2-like isoform 1 [Glycine max] Back     alignment and taxonomy information
>gi|357519279|ref|XP_003629928.1| Cytochrome P450 [Medicago truncatula] gi|355523950|gb|AET04404.1| Cytochrome P450 [Medicago truncatula] Back     alignment and taxonomy information
>gi|255564830|ref|XP_002523409.1| cytochrome P450, putative [Ricinus communis] gi|223537359|gb|EEF38988.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224056935|ref|XP_002299097.1| cytochrome P450 [Populus trichocarpa] gi|222846355|gb|EEE83902.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|86279654|gb|ABC94482.1| putative taxane 13-alpha-hydroxylase cytochrome P450 [Artemisia annua] Back     alignment and taxonomy information
>gi|297736038|emb|CBI24076.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147789083|emb|CAN75788.1| hypothetical protein VITISV_041016 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query437
TAIR|locus:2158961477 CYP716A1 ""cytochrome P450, fa 0.643 0.589 0.447 4.7e-97
UNIPROTKB|Q84KI1509 Q84KI1 "Taxoid 14-beta-hydroxy 0.610 0.524 0.392 3.2e-77
TAIR|locus:2052396485 CYP718 ""cytochrome P450, fami 0.597 0.538 0.423 8.6e-73
TAIR|locus:2158480463 CYP707A3 ""cytochrome P450, fa 0.588 0.555 0.384 2.9e-60
TAIR|locus:2066138482 CYP707A2 ""cytochrome P450, fa 0.597 0.541 0.393 8.8e-59
TAIR|locus:2094058468 CYP707A4 ""cytochrome P450, fa 0.601 0.561 0.353 1.6e-55
TAIR|locus:2134781484 CYP707A1 ""cytochrome P450, fa 0.537 0.485 0.369 1.8e-54
UNIPROTKB|Q5CCK3506 OsDWARF4 "Cytochrome P450" [Or 0.620 0.535 0.333 4.8e-54
UNIPROTKB|Q8H848502 OJ1626B05.9 "Putative steroid 0.620 0.539 0.333 4.8e-54
TAIR|locus:2101704513 DWF4 "DWARF 4" [Arabidopsis th 0.471 0.401 0.366 4.9e-54
TAIR|locus:2158961 CYP716A1 ""cytochrome P450, family 716, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 672 (241.6 bits), Expect = 4.7e-97, Sum P(2) = 4.7e-97
 Identities = 133/297 (44%), Positives = 196/297 (65%)

Query:   142 SFLSPNALMKYVERIDMITQQHIATYWEGVMSFPVNFPGTTFYKSIRAADAIREELIKLI 201
             SFLS    M+   R+  + +Q   T   G+ S P++ PGT F ++I+A+  +R+E +  I
Sbjct:   189 SFLS----MEDPARVRQLEEQ-FNTVAVGIFSIPIDLPGTRFNRAIKASRLLRKE-VSAI 242

Query:   202 AKQTREALGS-----KQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSSAITL 256
              +Q +E L +     + D+LS +++   + G+   E ++AD I+ LL   HDT+S   T 
Sbjct:   243 VRQRKEELKAGKALEEHDILSHMLM---NIGETKDE-DLADKIIGLLIGGHDTASIVCTF 298

Query:   257 LLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPPAIGA 316
             ++ YL + P V++ VL+EQ  I + K++ E L+WEDI+KM+Y+WNVA EVMR+ PP  G 
Sbjct:   299 VVNYLAEFPHVYQRVLQEQKEILKEKKEKEGLRWEDIEKMRYSWNVACEVMRIVPPLSGT 358

Query:   317 FREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSYVPFG 376
             FREA+  F++ G+ IPKGWKL+WS  +TH +   FP PE F+ +RFE  G  PY+YVPFG
Sbjct:   359 FREAIDHFSFKGFYIPKGWKLYWSATATHMNPDYFPEPERFEPNRFEGSGPKPYTYVPFG 418

Query:   377 GGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDE-KFGYDPMLSPSQGLPIRLQP 432
             GGPRMCPG E+ RL IL+F+HN++ RFKW+ + P+E K   DP+  P +GLPIR+ P
Sbjct:   419 GGPRMCPGKEYARLEILIFMHNLVNRFKWEKVFPNENKIVVDPLPIPDKGLPIRIFP 475
GO:0005506 "iron ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=ISM
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
UNIPROTKB|Q84KI1 Q84KI1 "Taxoid 14-beta-hydroxylase" [Taxus cuspidata (taxid:99806)] Back     alignment and assigned GO terms
TAIR|locus:2052396 CYP718 ""cytochrome P450, family 718"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2158480 CYP707A3 ""cytochrome P450, family 707, subfamily A, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2066138 CYP707A2 ""cytochrome P450, family 707, subfamily A, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094058 CYP707A4 ""cytochrome P450, family 707, subfamily A, polypeptide 4"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2134781 CYP707A1 ""cytochrome P450, family 707, subfamily A, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q5CCK3 OsDWARF4 "Cytochrome P450" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q8H848 OJ1626B05.9 "Putative steroid 22-alpha-hydroxylase" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2101704 DWF4 "DWARF 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.13.78LOW CONFIDENCE prediction!
3rd Layer4.2.1LOW CONFIDENCE prediction!
4th Layer1.14.14.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_fgenesh4_pg.C_LG_I0025
Cytochrome P450 (483 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 8e-79
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 7e-69
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 5e-68
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-61
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 1e-58
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 1e-52
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 9e-50
pfam00067461 pfam00067, p450, Cytochrome P450 2e-37
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 7e-20
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-17
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 2e-14
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-13
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-12
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 3e-12
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 5e-12
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-11
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 1e-11
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 1e-10
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-10
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 5e-10
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 6e-10
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-09
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 3e-08
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 6e-08
pfam00067461 pfam00067, p450, Cytochrome P450 5e-06
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-06
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 1e-05
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 5e-05
PLN02648480 PLN02648, PLN02648, allene oxide synthase 2e-04
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information 
 Score =  251 bits (642), Expect = 8e-79
 Identities = 148/478 (30%), Positives = 232/478 (48%), Gaps = 67/478 (14%)

Query: 1   MEFTIFSLCIAFALLFVFFYPLIITV-KLKEKIYPNPHLPPGNLGWPVIGETLGFIRAGF 59
           M+F+   L +    LF+     +    +      P   LPPG +GWP +GET       +
Sbjct: 1   MDFSALFLTLFAGALFLCLLRFLAGFRRSSSTKLP---LPPGTMGWPYVGETFQL----Y 53

Query: 60  EGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWPSSVGKL 119
              P  F   + ++Y S VFKT +LG   ++       K +   ++ L +  +P+S  ++
Sbjct: 54  SQDPNVFFASKQKRYGS-VFKTHVLGCPCVMISSPEAAKFVLVTKSHLFKPTFPASKERM 112

Query: 120 F-KTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWEGVM------ 172
             K  +    GD   ++R++++ +F+ P+A+   V  I+ I Q+ +   WEG        
Sbjct: 113 LGKQAIFFHQGDYHAKLRKLVLRAFM-PDAIRNMVPDIESIAQESL-NSWEGTQINTYQE 170

Query: 173 -------------------------------------SFPVNFPGTTFYKSIRAADAIRE 195
                                                S P+N PGT F+KS++A    R+
Sbjct: 171 MKTYTFNVALLSIFGKDEVLYREDLKRCYYILEKGYNSMPINLPGTLFHKSMKA----RK 226

Query: 196 ELIKLIAK---QTREALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLFSSHDTSSS 252
           EL +++AK   + R+   S  DLL     + D  G  LT+ ++ADNI+ ++F++ DT++S
Sbjct: 227 ELAQILAKILSKRRQNGSSHNDLLGSF--MGDKEG--LTDEQIADNIIGVIFAARDTTAS 282

Query: 253 AITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVASEVMRLSPP 312
            +T +LKYL + P V E V  EQ+ I + KE+GE L WED +KM  T  V  E +R++  
Sbjct: 283 VLTWILKYLAENPSVLEAVTEEQMAIRKDKEEGESLTWEDTKKMPLTSRVIQETLRVASI 342

Query: 313 AIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREGATPYSY 372
               FREA+ D  Y GY IPKGWK+     + H    +F +P  FD SRFE     P ++
Sbjct: 343 LSFTFREAVEDVEYEGYLIPKGWKVLPLFRNIHHSADIFSDPGKFDPSRFE-VAPKPNTF 401

Query: 373 VPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPMLSPSQGLPIRL 430
           +PFG G   CPG E  +L I V IH++  +++W ++       Y P   P  GLPI L
Sbjct: 402 MPFGNGTHSCPGNELAKLEISVLIHHLTTKYRWSIVGTSNGIQYGPFALPQNGLPIAL 459

Length = 463
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 437
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 100.0
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=7e-73  Score=531.72  Aligned_cols=390  Identities=24%  Similarity=0.357  Sum_probs=318.1

Q ss_pred             CCCCCCCcccccccchHHHHhhccCCCchHHHHHHHHhhCCceEEEeeCCCcEEEEeCcchhhhcccccccceeccCh-h
Q 013728           36 PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTWWP-S  114 (437)
Q Consensus        36 ~~~ppgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~yG~~v~~~~~~~~~~v~v~~~~~i~~i~~~~~~~~~~~~~-~  114 (437)
                      .++||||++||+|||++++..    ..+|+.+.+|.++||| +|++++|..++|+++|++.++|++.+++..|.++.. .
T Consensus        25 ~~lPPGP~~lPiIGnl~~l~~----~~~h~~~~~ls~~yGp-i~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~   99 (489)
T KOG0156|consen   25 RNLPPGPPPLPIIGNLHQLGS----LPPHRSFRKLSKKYGP-VFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPT   99 (489)
T ss_pred             CCCCcCCCCCCccccHHHcCC----CchhHHHHHHHHHhCC-eEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCch
Confidence            789999999999999999985    3599999999999999 999999999999999999999999999888886664 2


Q ss_pred             hh-Hhhh-cc-ccccc-cChHHHHHHHhhhhccCCHHHHHHHHHHHHHHHHHHHHHhh-----c----------------
Q 013728          115 SV-GKLF-KT-CLLMK-AGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYW-----E----------------  169 (437)
Q Consensus       115 ~~-~~~~-g~-~l~~~-~g~~~~~~R~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-----~----------------  169 (437)
                      .. ..+. |. ++.++ +|+.|+.+||.....+++...++++...-.++++.+++...     .                
T Consensus       100 ~~~~~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI  179 (489)
T KOG0156|consen  100 ATLKYLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVI  179 (489)
T ss_pred             hhHHHhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHH
Confidence            23 3333 33 77666 89999999999988899988888766655555555444322     1                


Q ss_pred             -----------------------------------cccccC---ccCCCh--hhHHHHHHHHHHHHHHHHHHHHHHHHhc
Q 013728          170 -----------------------------------GVMSFP---VNFPGT--TFYKSIRAADAIREELIKLIAKQTREAL  209 (437)
Q Consensus       170 -----------------------------------~~~~~~---~~~p~~--~~~~~~~~~~~~~~~~~~~i~~~~~~~~  209 (437)
                                                         ....+|   .++++.  ..++.......+..++++.|++ +++..
T Consensus       180 ~~~~fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~e-h~~~~  258 (489)
T KOG0156|consen  180 CRMLFGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDE-HREKI  258 (489)
T ss_pred             HHHHhCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHH-HHhhh
Confidence                                               111122   122211  2234445555588889999988 65532


Q ss_pred             C-C-chhHHHHHHHHHhhcCCC-CCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHccCcHHHHHHHHHHHHhhhhcccCC
Q 013728          210 G-S-KQDLLSRLVVIADSNGKF-LTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGE  286 (437)
Q Consensus       210 ~-~-~~~~l~~ll~~~~~~~~~-lt~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~~~~~~~~~  286 (437)
                      + + ..|+++.+++..++++.+ +|++++.+.+.++++||+|||++++.|++.+|++||++|+|+++||+++++   .++
T Consensus       259 ~~~~~~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG---~~r  335 (489)
T KOG0156|consen  259 GDEEGRDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVG---KGR  335 (489)
T ss_pred             ccCCCCcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhC---CCC
Confidence            1 2 479999999997755444 899999999999999999999999999999999999999999999999987   345


Q ss_pred             CCCHHHhhcChHHHHHHHHhhcCCCCCc-ccccccccccccCCeeeCCCCEEeeccccccCCCCCCCCCCCCCCCCCCCC
Q 013728          287 LLKWEDIQKMKYTWNVASEVMRLSPPAI-GAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFERE  365 (437)
Q Consensus       287 ~~~~~~l~~lp~l~a~i~E~lRl~p~~~-~~~R~~~~d~~i~g~~ip~G~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~  365 (437)
                      .++.+|+.+||||+|+|+|++|++|++| .++|.+.+|+.++||.|||||.|+++.|++||||++|+||++|+||||+++
T Consensus       336 ~v~e~D~~~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~  415 (489)
T KOG0156|consen  336 LVSESDLPKLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDS  415 (489)
T ss_pred             CCChhhhccCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCC
Confidence            5999999999999999999999999999 678999999999999999999999999999999999999999999999986


Q ss_pred             C---CCCCcccccCCCCCCCccHHHHHHHHHHHHHHHHhhCceEeeCCCCCccc-ccccCCCCCccEEEeecc
Q 013728          366 G---ATPYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGY-DPMLSPSQGLPIRLQPHQ  434 (437)
Q Consensus       366 ~---~~~~~~~~FG~G~~~C~G~~~a~~~~~~~l~~ll~~f~~~~~~~~~~~~~-~~~~~~~~~~~v~~~~r~  434 (437)
                      +   .....++|||.|+|.|||..+|.+++.++++.|+++|||++.++...... ..+...+.++.+...+|.
T Consensus       416 ~d~~~~~~~~iPFG~GRR~CpG~~La~~~l~l~la~llq~F~w~~~~~~~d~~e~~~~~~~~~pl~~~~~~r~  488 (489)
T KOG0156|consen  416 NDGKGLDFKLIPFGSGRRICPGEGLARAELFLFLANLLQRFDWKLPGGKVDMEEAGLTLKKKKPLKAVPVPRL  488 (489)
T ss_pred             ccccCCceEecCCCCCcCCCCcHHHHHHHHHHHHHHHHheeeeecCCCCCCCcccccceecCCcceeeeecCC
Confidence            2   36778999999999999999999999999999999999999754111111 133444555666655553

>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 3e-54
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 3e-19
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 1e-17
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 3e-17
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-15
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 3e-15
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 3e-15
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 1e-13
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 1e-13
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-13
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 1e-13
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 1e-13
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 2e-13
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 4e-13
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 4e-13
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 6e-13
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 9e-13
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 1e-12
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 1e-12
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-12
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 2e-12
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-12
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-12
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 4e-12
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 6e-12
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 7e-12
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-12
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 7e-12
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 7e-12
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 7e-12
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 7e-12
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 7e-12
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 8e-12
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 8e-12
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 8e-12
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 9e-12
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 1e-11
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-11
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-11
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-11
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-11
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-11
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-11
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-11
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-11
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 2e-11
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-11
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-11
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-11
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 2e-11
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-11
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 2e-11
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-11
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-11
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 3e-11
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-11
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 4e-11
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 4e-11
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 4e-11
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-11
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 9e-11
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 9e-11
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 9e-11
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 1e-10
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 1e-10
1pkf_A419 Crystal Structure Of Epothilone D-Bound Cytochrome 1e-10
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-10
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-10
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 2e-10
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-10
1q5d_A419 Epothilone B-Bound Cytochrome P450epok Length = 419 3e-10
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-10
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 3e-10
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 4e-10
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 5e-10
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 7e-10
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 9e-10
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-09
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 3e-09
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-09
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 4e-09
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 5e-09
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 5e-09
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 5e-09
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 1e-08
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 1e-08
3zsn_A417 Structure Of The Mixed-Function P450 Mycg F286a Mut 2e-08
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 2e-08
2y46_A417 Structure Of The Mixed-Function P450 Mycg In Comple 3e-08
4aw3_A417 Structure Of The Mixed-Function P450 Mycg F286v Mut 3e-08
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 4e-08
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 4e-08
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 5e-08
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-07
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 1e-07
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 1e-07
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 1e-07
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 2e-07
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 2e-07
3a4g_A411 Structure Of Cytochrome P450 Vdh From Pseudonocardi 4e-07
2wm4_A435 X-Ray Structure Of Mycobacterium Tuberculosis Cytoc 5e-07
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 5e-07
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 5e-07
3a4z_A411 Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Ob 5e-07
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 6e-07
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 7e-07
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 7e-07
2rfb_A343 Crystal Structure Of A Cytochrome P450 From The The 8e-07
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 9e-07
2xkr_A398 Crystal Structure Of Mycobacterium Tuberculosis Cyp 9e-07
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 1e-06
2vz7_A436 Crystal Structure Of The Yc-17-Bound Pikc D50n Muta 1e-06
2whw_A436 Selective Oxidation Of Carbolide C-H Bonds By Engin 1e-06
2bvj_A436 Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp1 1e-06
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 2e-06
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-06
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 2e-06
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 2e-06
2d09_A407 A Role For Active Site Water Molecules And Hydroxyl 2e-06
3tzo_A410 The Role Of I87 Of Cyp158a2 In Oxidative Coupling R 2e-06
1t93_A406 Evidence For Multiple Substrate Recognition And Mol 2e-06
1s1f_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 3e-06
3tnk_A407 Crystal Structure Of Mutant I87r In Cyp158a2 Length 3e-06
1se6_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 3e-06
2d0e_A407 Substrate Assited In Oxygen Activation In Cytochrom 3e-06
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 3e-06
1jio_A403 P450eryf/6deb Length = 403 3e-06
3abb_A408 Crystal Structure Of Cyp105d6 Length = 408 4e-06
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 4e-06
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 4e-06
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 5e-06
3dam_A473 Crystal Structure Of Allene Oxide Synthase Length = 5e-06
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 5e-06
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 6e-06
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 7e-06
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 7e-06
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 7e-06
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 7e-06
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 8e-06
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 9e-06
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 1e-05
3pm0_A507 Structural Characterization Of The Complex Between 1e-05
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 1e-05
1odo_A408 1.85 A Structure Of Cyp154a1 From Streptomyces Coel 1e-05
1izo_A417 Cytochrome P450 Bs Beta Complexed With Fatty Acid L 2e-05
3e5l_A403 Crystal Structure Of Cyp105p1 H72a Mutant Length = 2e-05
3e5j_A403 Crystal Structure Of Cyp105p1 Wild-type Ligand-free 2e-05
3aba_A403 Crystal Structure Of Cyp105p1 In Complex With Filip 2e-05
2yoo_A407 Cholest-4-en-3-one Bound Structure Of Cyp142 From M 3e-05
3ofu_A396 Crystal Structure Of Cytochrome P450 Cyp101c1 Lengt 4e-05
3cv9_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
2zby_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
2zbx_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 4e-05
3cv8_A412 Crystal Structure Of Vitamin D Hydroxylase Cytochro 5e-05
2x9p_A404 X-Ray Structure Of The Substrate-Free Cytochrome P4 9e-05
3rwl_A426 Structure Of P450pyr Hydroxylase Length = 426 1e-04
2fr7_A412 Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt 1e-04
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 2e-04
1ued_A406 Crystal Structure Of Oxyc A Cytochrome P450 Implica 2e-04
2rcm_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 2e-04
2rch_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 3e-04
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 3e-04
2z36_A413 Crystal Structure Of Cytochrome P450 Moxa From Nono 3e-04
4dxy_A417 Crystal Structures Of Cyp101d2 Y96a Mutant Length = 5e-04
3nv5_A452 Crystal Structure Of Cytochrome P450 Cyp101d2 Lengt 5e-04
2nz5_A413 Structure And Function Studies Of Cytochrome P450 1 6e-04
2dkk_A411 Structure/function Studies Of Cytochrome P450 158a1 7e-04
3tkt_A450 Crystal Structure Of Cyp108d1 From Novosphingobium 7e-04
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (531), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 137/418 (32%), Positives = 205/418 (49%), Gaps = 60/418 (14%)
Query: 38  LPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGH 97
           +PPG+ G P +GETL F+  G  GK      +R +++   +FKT L G+++I   G   +
Sbjct: 13  IPPGDFGLPWLGETLNFLNDGDFGK------KRQQQFGP-IFKTRLFGKNVIFISGALAN 65
Query: 98  KLLFSNENKLVRTWWPSSVGKLF-KTCLLMKAGDDAKXXXXXXXXSFLSPNALMKYVERI 156
           + LF+ E +  +  WP S   L     L  + G+  +        +FL P  L  Y+ ++
Sbjct: 66  RFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILYQAFL-PRTLDSYLPKM 124
Query: 157 DMITQQHIA------------------------------------------TYWEGVMSF 174
           D I Q ++                                           TY +G+ S 
Sbjct: 125 DGIVQGYLEQWGKANEVIWYPQLRRMTFDVAATLFMGEKVSQNPQLFPWFETYIQGLFSL 184
Query: 175 PVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTEME 234
           P+  P T F KS RA   +  EL K+I K  ++   S++D L  L+   D N + L+  E
Sbjct: 185 PIPLPNTLFGKSQRARALLLAELEKII-KARQQQPPSEEDALGILLAARDDNNQPLSLPE 243
Query: 235 VADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQ 294
           + D ILLLLF+ H+T +SA++     LGQ   + E V +EQ  +  S+E    L  E ++
Sbjct: 244 LKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQEQNKLQLSQE----LTAETLK 299
Query: 295 KMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNP 354
           KM Y   V  EV+RL PP  G FRE + D  + G+  PKGW + +    TH D  L+P+P
Sbjct: 300 KMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYPDP 359
Query: 355 ETFDASRFEREGAT----PYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLL 408
           E FD  RF  +G+     P+++VPFGGG R C G EF RL + +F   +I++F W LL
Sbjct: 360 EKFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQQFDWTLL 417
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|1PKF|A Chain A, Crystal Structure Of Epothilone D-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|1Q5D|A Chain A, Epothilone B-Bound Cytochrome P450epok Length = 419 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|3ZSN|A Chain A, Structure Of The Mixed-Function P450 Mycg F286a Mutant In Complex With Mycinamicin Iv Length = 417 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|2Y46|A Chain A, Structure Of The Mixed-Function P450 Mycg In Complex With Mycinamicin Iv In C 2 2 21 Space Group Length = 417 Back     alignment and structure
>pdb|4AW3|A Chain A, Structure Of The Mixed-Function P450 Mycg F286v Mutant In Complex With Mycinamicin V In P1 Space Group Length = 417 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|3A4G|A Chain A, Structure Of Cytochrome P450 Vdh From Pseudonocardia Autotrophica (Trigonal Crystal Form) Length = 411 Back     alignment and structure
>pdb|2WM4|A Chain A, X-Ray Structure Of Mycobacterium Tuberculosis Cytochrome P450 Cyp124 In Complex With Phytanic Acid Length = 435 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3A4Z|A Chain A, Structure Of Cytochrome P450 Vdh Mutant (Vdh-K1) Obtained By Directed Evolution Length = 411 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|2RFB|A Chain A, Crystal Structure Of A Cytochrome P450 From The Thermoacidophilic Archaeon Picrophilus Torridus Length = 343 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|2XKR|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp142: A Novel Cholesterol Oxidase Length = 398 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|2VZ7|A Chain A, Crystal Structure Of The Yc-17-Bound Pikc D50n Mutant Length = 436 Back     alignment and structure
>pdb|2WHW|A Chain A, Selective Oxidation Of Carbolide C-H Bonds By Engineered Macrolide P450 Monooxygenase Length = 436 Back     alignment and structure
>pdb|2BVJ|A Chain A, Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp107l1) Length = 436 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|2D09|A Chain A, A Role For Active Site Water Molecules And Hydroxyl Groups Of Substrate For Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|3TZO|A Chain A, The Role Of I87 Of Cyp158a2 In Oxidative Coupling Reaction Length = 410 Back     alignment and structure
>pdb|1T93|A Chain A, Evidence For Multiple Substrate Recognition And Molecular Mechanism Of C-C Reaction By Cytochrome P450 Cyp158a2 From Streptomyces Coelicolor A3(2) Length = 406 Back     alignment and structure
>pdb|1S1F|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|3TNK|A Chain A, Crystal Structure Of Mutant I87r In Cyp158a2 Length = 407 Back     alignment and structure
>pdb|1SE6|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|2D0E|A Chain A, Substrate Assited In Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|3ABB|A Chain A, Crystal Structure Of Cyp105d6 Length = 408 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3DAM|A Chain A, Crystal Structure Of Allene Oxide Synthase Length = 473 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|1ODO|A Chain A, 1.85 A Structure Of Cyp154a1 From Streptomyces Coelicolor A3(2) Length = 408 Back     alignment and structure
>pdb|1IZO|A Chain A, Cytochrome P450 Bs Beta Complexed With Fatty Acid Length = 417 Back     alignment and structure
>pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 Back     alignment and structure
>pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 Back     alignment and structure
>pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 Back     alignment and structure
>pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From Mycobacterium Smegmatis Length = 407 Back     alignment and structure
>pdb|3OFU|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101c1 Length = 396 Back     alignment and structure
>pdb|3CV9|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R73aR84A MUTANT) IN COMPLEX WITH 1ALPHA,25- Dihydroxyvitamin D3 Length = 412 Back     alignment and structure
>pdb|2ZBY|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84a Mutant) Length = 412 Back     alignment and structure
>pdb|2ZBX|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (Wild Type) With Imidazole Bound Length = 412 Back     alignment and structure
>pdb|3CV8|A Chain A, Crystal Structure Of Vitamin D Hydroxylase Cytochrome P450 105a1 (R84f Mutant) Length = 412 Back     alignment and structure
>pdb|2X9P|A Chain A, X-Ray Structure Of The Substrate-Free Cytochrome P450 Pimd - A Polyene Macrolide Antibiotic Pimaricin Epoxidase Length = 404 Back     alignment and structure
>pdb|3RWL|A Chain A, Structure Of P450pyr Hydroxylase Length = 426 Back     alignment and structure
>pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|1UED|A Chain A, Crystal Structure Of Oxyc A Cytochrome P450 Implicated In An Oxidative C-C Coupling Reaction During Vancomycin Biosynthesis. Length = 406 Back     alignment and structure
>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 74a) At 1.73 A Resolution Length = 495 Back     alignment and structure
>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 13(S)-Hod At 1.85 A Resolution Length = 495 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|2Z36|A Chain A, Crystal Structure Of Cytochrome P450 Moxa From Nonomuraea Recticatena (Cyp105) Length = 413 Back     alignment and structure
>pdb|4DXY|A Chain A, Crystal Structures Of Cyp101d2 Y96a Mutant Length = 417 Back     alignment and structure
>pdb|3NV5|A Chain A, Crystal Structure Of Cytochrome P450 Cyp101d2 Length = 452 Back     alignment and structure
>pdb|2NZ5|A Chain A, Structure And Function Studies Of Cytochrome P450 158a1 From Streptomyces Coelicolor A3(2) Length = 413 Back     alignment and structure
>pdb|2DKK|A Chain A, Structure/function Studies Of Cytochrome P450 158a1 From Streptomyces Coelicolor A3(2) Length = 411 Back     alignment and structure
>pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query437
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-149
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 1e-110
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 1e-105
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 2e-87
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 8e-83
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 1e-76
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 7e-72
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-68
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 3e-66
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 1e-64
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 7e-49
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-48
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-43
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-43
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-08
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 6e-41
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-04
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 3e-40
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 4e-40
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 3e-36
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-30
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 9e-22
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 1e-20
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 1e-20
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 3e-20
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 4e-20
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 1e-19
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 3e-19
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 3e-19
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 4e-19
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 6e-19
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 7e-19
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 7e-19
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 8e-19
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 8e-19
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 1e-18
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 1e-18
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-18
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 1e-18
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-18
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 1e-18
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-18
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 2e-18
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 3e-18
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 3e-18
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 3e-18
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 4e-18
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 4e-18
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 4e-18
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 5e-18
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 5e-18
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 6e-18
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 2e-17
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-17
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 3e-17
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 3e-17
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 3e-17
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 3e-17
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 4e-17
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 4e-17
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 5e-17
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 6e-17
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-16
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 2e-16
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 4e-16
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 6e-16
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 8e-16
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 8e-16
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-15
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 1e-15
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 2e-15
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 2e-15
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 2e-15
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 4e-15
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 1e-14
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 3e-13
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 7e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
 Score =  429 bits (1106), Expect = e-149
 Identities = 138/445 (31%), Positives = 213/445 (47%), Gaps = 61/445 (13%)

Query: 36  PHLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTA 95
             +PPG+ G P +GETL F+          F ++R +++   +FKT L G+++I   G  
Sbjct: 11  LPIPPGDFGLPWLGETLNFLN------DGDFGKKRQQQF-GPIFKTRLFGKNVIFISGAL 63

Query: 96  GHKLLFSNENKLVRTWWPSSVGKLF-KTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVE 154
            ++ LF+ E +  +  WP S   L     L  + G+  +  R+++      P  L  Y+ 
Sbjct: 64  ANRFLFTKEQETFQATWPLSTRILLGPNALATQMGEIHRSRRKILY-QAFLPRTLDSYLP 122

Query: 155 RIDMITQQHIA------------------------------------------TYWEGVM 172
           ++D I Q ++                                           TY +G+ 
Sbjct: 123 KMDGIVQGYLEQWGKANEVIWYPQLRRMTFDVAATLFMGEKVSQNPQLFPWFETYIQGLF 182

Query: 173 SFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVVIADSNGKFLTE 232
           S P+  P T F KS RA   +  EL K+I K  ++   S++D L  L+   D N + L+ 
Sbjct: 183 SLPIPLPNTLFGKSQRARALLLAELEKII-KARQQQPPSEEDALGILLAARDDNNQPLSL 241

Query: 233 MEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWED 292
            E+ D ILLLLF+ H+T +SA++     LGQ   + E V +EQ  +  S+E    L  E 
Sbjct: 242 PELKDQILLLLFAGHETLTSALSSFCLLLGQHSDIRERVRQEQNKLQLSQE----LTAET 297

Query: 293 IQKMKYTWNVASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFP 352
           ++KM Y   V  EV+RL PP  G FRE + D  + G+  PKGW + +    TH D  L+P
Sbjct: 298 LKKMPYLDQVLQEVLRLIPPVGGGFRELIQDCQFQGFHFPKGWLVSYQISQTHADPDLYP 357

Query: 353 NPETFDASRFEREGAT----PYSYVPFGGGPRMCPGYEFERLLILVFIHNMIKRFKWDLL 408
           +PE FD  RF  +G+     P+++VPFGGG R C G EF RL + +F   +I++F W LL
Sbjct: 358 DPEKFDPERFTPDGSATHNPPFAHVPFGGGLRECLGKEFARLEMKLFATRLIQQFDWTLL 417

Query: 409 I-PDEKFGYDPMLSPSQGLPIRLQP 432
              + +    P   P   L ++L  
Sbjct: 418 PGQNLELVVTPSPRPKDNLRVKLHS 442
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 100.0
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 100.0
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 100.0
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 100.0
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 100.0
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 100.0
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 100.0
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 100.0
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 100.0
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 100.0
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 100.0
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 100.0
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 100.0
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 100.0
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 100.0
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 100.0
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 100.0
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 100.0
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 100.0
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 100.0
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 100.0
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 100.0
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 100.0
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
Probab=100.00  E-value=1e-73  Score=551.43  Aligned_cols=392  Identities=22%  Similarity=0.363  Sum_probs=338.3

Q ss_pred             CCCCCCCCCcc-cccccchHHHHhhccCCCchHHHHHHHHhhCCceEEEeeCCCcEEEEeCcchhhhcccccccceecc-
Q 013728           34 PNPHLPPGNLG-WPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTW-  111 (437)
Q Consensus        34 ~~~~~ppgp~~-~p~~G~~~~~~~~~~~~~~~~~~~~~~~~yG~~v~~~~~~~~~~v~v~~~~~i~~i~~~~~~~~~~~-  111 (437)
                      +..+.||+|++ +|+|||++++.+     +++.++.++++|||+ ||++++++.++|+++|++++++++.+++..+... 
T Consensus         8 ~g~~~PP~~~~~lP~iG~~~~~~~-----~~~~~~~~~~~kYG~-i~~~~~~~~~~vvv~~~~~i~~il~~~~~~~~~~~   81 (461)
T 3ld6_A            8 AGVKSPPYIFSPIPFLGHAIAFGK-----SPIEFLENAYEKYGP-VFSFTMVGKTFTYLLGSDAAALLFNSKNEDLNAED   81 (461)
T ss_dssp             --CCCCCBCCCSSTTTBTHHHHHH-----CHHHHHHHHHHHHCS-EEEEEETTEEEEEECSHHHHHHHHHCCTTTEESHH
T ss_pred             cCCCCCCCCCCCcCeeeeHHHhhh-----CHHHHHHHHHHHhCC-EEEEEECCccEEEEeCHHHHHHHHhCCccccCCCc
Confidence            34467888886 799999999985     799999999999999 9999999999999999999999998776555533 


Q ss_pred             -ChhhhHhhhcccc-ccccChHHHHHHHhhhhccCCHHHHHHHHHHHHHHHHHHHHHhhc--------------------
Q 013728          112 -WPSSVGKLFKTCL-LMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWE--------------------  169 (437)
Q Consensus       112 -~~~~~~~~~g~~l-~~~~g~~~~~~R~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~--------------------  169 (437)
                       +......++|.++ +..+|+.|+++|+.+ .+.|+...++.+.+.+.+.++++++....                    
T Consensus        82 ~~~~~~~~~~g~~~~~~~~~~~~~~~R~~~-~~~f~~~~l~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  160 (461)
T 3ld6_A           82 VYSRLTTPVFGKGVAYDVPNPVFLEQKKML-KSGLNIAHFKQHVSIIEKETKEYFESWGESGEKNVFEALSELIILTASH  160 (461)
T ss_dssp             HHHHHHHHHHCTTSGGGSCHHHHHHHHHHH-HHHSSHHHHHHHHHHHHHHHHHHGGGGCSEEEEEHHHHHHHHHHHHHHH
T ss_pred             chhhhhhccCCCccccCCCcHHHHHHHHhc-cccccHHHHhhhhHHHHHHHHHHHHHHhhcCCccHHHHHHHHHHHHHHH
Confidence             2233445677765 457899999999999 88999999999999999999988874222                    


Q ss_pred             ----------------------------cccccCccCCChhhHHHHHHHHHHHHHHHHHHHHHHHHhcCCchhHHHHHHH
Q 013728          170 ----------------------------GVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALGSKQDLLSRLVV  221 (437)
Q Consensus       170 ----------------------------~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~l~~ll~  221 (437)
                                                  ....++.+++.+.+.+..++.+.+.+++.+.+++ ++...+...|+++.|++
T Consensus       161 ~~fG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i~~-r~~~~~~~~d~l~~ll~  239 (461)
T 3ld6_A          161 CLHGKEIRSQLNEKVAQLYADLDGGFSHAAWLLPGWLPLPSFRRRDRAHREIKDIFYKAIQK-RRQSQEKIDDILQTLLD  239 (461)
T ss_dssp             HHTCHHHHHTCCHHHHHHHHHHHTTSSHHHHHSCTTSCCHHHHHHHHHHHHHHHHHHHHHHH-HTTCCCCCCSHHHHHHT
T ss_pred             HHcCcchhhhhhhhhhhhhhhhhhhhhhHHHhhhhhccCcHHHHHHHHHHHHHHHHHHHHHH-HHhcCCCCcchhhhhHH
Confidence                                        1123455667777777888888899999999887 66544347789999998


Q ss_pred             HHhhcCCCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHccCcHHHHHHHHHHHHhhhhcccCCCCCHHHhhcChHHHH
Q 013728          222 IADSNGKFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWN  301 (437)
Q Consensus       222 ~~~~~~~~lt~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~~~~~~~~~~~~~~~l~~lp~l~a  301 (437)
                      ...+++..+|++++.+++.++++||+|||+++++|++++|+.||++|+|+++|++++++.  ....++.+++++||||+|
T Consensus       240 ~~~~~~~~ls~~ei~~~~~~~~~aG~dTt~~~l~~~l~~L~~~P~~q~kl~~Ei~~v~~~--~~~~~~~~~l~~lpyl~a  317 (461)
T 3ld6_A          240 ATYKDGRPLTDDEVAGMLIGLLLAGQHTSSTTSAWMGFFLARDKTLQKKCYLEQKTVCGE--NLPPLTYDQLKDLNLLDR  317 (461)
T ss_dssp             CBCTTSCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHCT--TCCCCCHHHHHTCHHHHH
T ss_pred             hhhcccCCCCHHHHHHHHHhhhhcccccccccchhhhcccccChHHHHHHHHHHHHHhcc--cccchhHHHHHHHhhhhh
Confidence            877777779999999999999999999999999999999999999999999999999873  345689999999999999


Q ss_pred             HHHHhhcCCCCCcccccccccccccCCeeeCCCCEEeeccccccCCCCCCCCCCCCCCCCCCCCC---CCCCcccccCCC
Q 013728          302 VASEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREG---ATPYSYVPFGGG  378 (437)
Q Consensus       302 ~i~E~lRl~p~~~~~~R~~~~d~~i~g~~ip~G~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~---~~~~~~~~FG~G  378 (437)
                      ||+|+||++|+++...|.+.+|++++||.|||||.|+++.+.+||||++|+||++|+||||++++   ..+..|+|||+|
T Consensus       318 vi~E~lRl~p~~~~~~r~~~~d~~~~g~~ip~Gt~v~~~~~~~~~d~~~~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G  397 (461)
T 3ld6_A          318 CIKETLRLRPPIMIMMRMARTPQTVAGYTIPPGHQVCVSPTVNQRLKDSWVERLDFNPDRYLQDNPASGEKFAYVPFGAG  397 (461)
T ss_dssp             HHHHHHHHSCSCCCEEEEESSCEEETTEEECTTCEEEECHHHHTTCTTTCTTTTSCCGGGGGSCCHHHHSSSSSCTTCCG
T ss_pred             eeeeccccCCchhccccccccceeeCCcccCCCCeeeechHhhcCCccccCCccccCccccCCCCcccCCCCccccCCCc
Confidence            99999999999998899999999999999999999999999999999999999999999999874   456789999999


Q ss_pred             CCCCccHHHHHHHHHHHHHHHHhhCceEeeCCC-CCcccccccCCCCCccEEEeeccC
Q 013728          379 PRMCPGYEFERLLILVFIHNMIKRFKWDLLIPD-EKFGYDPMLSPSQGLPIRLQPHQC  435 (437)
Q Consensus       379 ~~~C~G~~~a~~~~~~~l~~ll~~f~~~~~~~~-~~~~~~~~~~~~~~~~v~~~~r~~  435 (437)
                      +|.|+|+++|++|++++++.|+++|||+++++. +......+..+++++.|+|+||+-
T Consensus       398 ~r~C~G~~lA~~e~~~~la~ll~~f~~~l~~~~~~~~~~~~~~~~p~~~~v~~~~Rss  455 (461)
T 3ld6_A          398 RHRCIGENFAYVQIKTIWSTMLRLYEFDLIDGYFPTVNYTTMIHTPENPVIRYKRRST  455 (461)
T ss_dssp             GGCCSCHHHHHHHHHHHHHHHHHHEEEECSTTCCCCBCCSSSSCCBSSCEEEEEECC-
T ss_pred             CcCChhHHHHHHHHHHHHHHHHHhCEEEeCCCCCCcccccceEEcCCceEEEEEECCC
Confidence            999999999999999999999999999998653 445555566677789999999974
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 437
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 1e-41
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 6e-36
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 5e-35
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 4e-29
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-09
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 8e-26
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 6e-25
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 4e-23
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 3e-21
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-10
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 5e-21
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-21
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 9e-21
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 3e-20
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 6e-20
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 2e-19
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 1e-17
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 3e-17
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 5e-17
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-15
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 3e-15
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-15
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-13
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 152a1 (Bs-beta)
species: Bacillus subtilis [TaxId: 1423]

 Score =  150 bits (378), Expect = 1e-41
 Identities = 71/433 (16%), Positives = 130/433 (30%), Gaps = 71/433 (16%)

Query: 45  WPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNE 104
              +  +L  ++     +   FI+ R E+Y+S +F+  LLG++ I   G    K+ +  +
Sbjct: 3   DKSLDNSLTLLK-----EGYLFIKNRTERYNSDLFQARLLGKNFICMTGAEAAKVFYDTD 57

Query: 105 NKLVRTWWPSSVGK-LFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQH 163
               +   P  V K LF    +      A   R+M+ +S ++P    +  E +    +  
Sbjct: 58  RFQRQNALPKRVQKSLFGVNAIQGMDGSAHIHRKMLFLSLMTPPHQKRLAELMTEEWKAA 117

Query: 164 IA----------------------TYWEGV----------------MSFPVNFPGTTFYK 185
           +                        YW GV                M       G   +K
Sbjct: 118 VTRWEKADEVVLFEEAKEILCRVACYWAGVPLKETEVKERADDFIDMVDAFGAVGPRHWK 177

Query: 186 SIRAADAIREELIKLIAKQTR-EALGSKQDLLSRLVVIADSNGKFLTEMEVADNILLLLF 244
             RA     E +  +I          +    L  +      +G  L     A  ++ +L 
Sbjct: 178 GRRARPRAEEWIEVMIEDARAGLLKTTSGTALHEMAFHTQEDGSQLDSRMAAIELINVLR 237

Query: 245 SSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVAS 304
                S   +   L                           +  +W      +       
Sbjct: 238 PIVAISYFLVFSALALHEHP---------------------KYKEWLRSGNSREREMFVQ 276

Query: 305 EVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFER 364
           EV R  P           DF ++     KG  +      T+ D  L+ +P+ F   RF  
Sbjct: 277 EVRRYYPFGPFLGALVKKDFVWNNCEFKKGTSVLLDLYGTNHDPRLWDHPDEFRPERFAE 336

Query: 365 EGATPYSYVPFGGG----PRMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGYDPML 420
                +  +P GGG       CPG      ++   +  ++ + ++D+      +    M 
Sbjct: 337 REENLFDMIPQGGGHAEKGHRCPGEGITIEVMKASLDFLVHQIEYDVPEQSLHYSLARMP 396

Query: 421 S-PSQGLPIRLQP 432
           S P  G  +    
Sbjct: 397 SLPESGFVMSGIR 409
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query437
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 100.0
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 100.0
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 100.0
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 100.0
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 100.0
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 100.0
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 100.0
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 100.0
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 100.0
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 100.0
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 100.0
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 100.0
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 100.0
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 100.0
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=100.00  E-value=1.7e-70  Score=524.97  Aligned_cols=385  Identities=18%  Similarity=0.313  Sum_probs=317.1

Q ss_pred             CCCCCCcccccccchHHHHhhccCCCchHHHHHHHHhhCCceEEEeeCCCcEEEEeCcchhhhcccccccceecc-Chhh
Q 013728           37 HLPPGNLGWPVIGETLGFIRAGFEGKPERFIRERMEKYDSRVFKTCLLGEDMIVFCGTAGHKLLFSNENKLVRTW-WPSS  115 (437)
Q Consensus        37 ~~ppgp~~~p~~G~~~~~~~~~~~~~~~~~~~~~~~~yG~~v~~~~~~~~~~v~v~~~~~i~~i~~~~~~~~~~~-~~~~  115 (437)
                      .+||+|++||++||++.|.     .|++.++.+++++||+ ||++++++.++++|+||+.++++++++...+... ....
T Consensus         1 ~lP~~p~~~P~iG~~~~f~-----~d~~~f~~~~~~kyG~-if~~~~~~~~~v~v~~p~~v~~i~~~~~~~~~~~~~~~~   74 (445)
T d2ciba1           1 ALPRVSGGHDEHGHLEEFR-----TDPIGLMQRVRDELGD-VGTFQLAGKQVVLLSGSHANEFFFRAGDDDLDQAKAYPF   74 (445)
T ss_dssp             CCCBCSCCCBTTBTHHHHT-----TCHHHHHHHHHHHHCS-EEEEEETTEEEEEECSHHHHHHHHHCCTTTEECTTSCGG
T ss_pred             CCCCCCCCcCcCcCHHHHh-----HCHHHHHHHHHHHHCC-EEEEEECCceEEEEcCHHHHHHHHhCCcccccCCccchh
Confidence            4799999999999999997     5899999999999999 9999999999999999999999998777656543 3445


Q ss_pred             hHhhhccccccccChHHHHHHHhhhhccCCHHHHHHHHHHHHHHHHHHHHHhhc--------------------------
Q 013728          116 VGKLFKTCLLMKAGDDAKRMRRMMMMSFLSPNALMKYVERIDMITQQHIATYWE--------------------------  169 (437)
Q Consensus       116 ~~~~~g~~l~~~~g~~~~~~R~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~--------------------------  169 (437)
                      +..++|.++++ +++.|++.|+.+ .+.+++..++.+.+.+.+.+.++++. |.                          
T Consensus        75 ~~~~~g~g~~~-~~~~~~~~~~~~-~~~~~~~~l~~~~~~i~~~~~~~~~~-l~~~~~vdl~~~~~~~~~~~~~~~~fG~  151 (445)
T d2ciba1          75 MTPIFGEGVVF-DASPERRKEMLH-NAALRGEQMKGHAATIEDQVRRMIAD-WGEAGEIDLLDFFAELTIYTSSACLIGK  151 (445)
T ss_dssp             GHHHHC----------------------CCHHHHHHHHHHHHHHHHHHHTT-CCSEEEEEHHHHHHHHHHHHHHHHHTCH
T ss_pred             hHhhcCCceee-cCchHHHHHHHh-ccccCccccccchHHHHHHHHHhhhh-cccCCCcchHHhhhhhcceeeeeccccc
Confidence            56677777654 677788888888 88899999999999999999999873 32                          


Q ss_pred             ----------------------cccccCccCCChhhHHHHHHHHHHHHHHHHHHHHHHHHhcC--C-chhHHHHHHHHHh
Q 013728          170 ----------------------GVMSFPVNFPGTTFYKSIRAADAIREELIKLIAKQTREALG--S-KQDLLSRLVVIAD  224 (437)
Q Consensus       170 ----------------------~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~--~-~~~~l~~ll~~~~  224 (437)
                                            .+...+.++|....++..++++.+.+++.++++. +++...  . ..|+++.|++...
T Consensus       152 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~i~~-~~~~~~~~~~~~dll~~ll~~~~  230 (445)
T d2ciba1         152 KFRDQLDGRFAKLYHELERGTDPLAYVDPYLPIESFRRRDEARNGLVALVADIMNG-RIANPPTDKSDRDMLDVLIAVKA  230 (445)
T ss_dssp             HHHTTCCHHHHHHHHHHHTTCCGGGGTCTTCSCHHHHHHHHHHHHHHHHHHHHHHH-HHHCC-----CCCHHHHHHHCBC
T ss_pred             cccchhhhHHHHHHHHhhhhhhhhccccchhhhHHHHHHHHHHHHHHHHHHHHHhh-hcccccccccccchhhhhhcccc
Confidence                                  2223344566667778888999999999999987 655433  2 6789999998765


Q ss_pred             hcC-CCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHccCcHHHHHHHHHHHHhhhhcccCCCCCHHHhhcChHHHHHH
Q 013728          225 SNG-KFLTEMEVADNILLLLFSSHDTSSSAITLLLKYLGQMPQVFENVLREQIGIAESKEQGELLKWEDIQKMKYTWNVA  303 (437)
Q Consensus       225 ~~~-~~lt~~~i~~~~~~~~~ag~~tt~~~l~~~l~~l~~~p~~~~kl~~Ei~~~~~~~~~~~~~~~~~l~~lp~l~a~i  303 (437)
                      +.+ ..++++++.++++.+++||++||+.+++|++++|+.||++|+++|+||+++.+   .+..++.+++.+||||++||
T Consensus       231 ~~~~~~ls~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~---~~~~~~~~~l~~lp~L~a~i  307 (445)
T d2ciba1         231 ETGTPRFSADEITGMFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYG---DGRSVSFHALRQIPQLENVL  307 (445)
T ss_dssp             TTSSBSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGG---GCCCHHHHTTSCCHHHHHHH
T ss_pred             ccccccCCcchhhhhhhhhhhhccccchhhccccccccccccccccccccccccccc---ccccchhhhcccchhhcccc
Confidence            443 35999999999999999999999999999999999999999999999999976   35678999999999999999


Q ss_pred             HHhhcCCCCCcccccccccccccCCeeeCCCCEEeeccccccCCCCCCCCCCCCCCCCCCCCC----CCCCcccccCCCC
Q 013728          304 SEVMRLSPPAIGAFREALVDFTYSGYTIPKGWKLHWSTGSTHKDETLFPNPETFDASRFEREG----ATPYSYVPFGGGP  379 (437)
Q Consensus       304 ~E~lRl~p~~~~~~R~~~~d~~i~g~~ip~G~~v~~~~~~~~~d~~~~~~p~~F~P~R~l~~~----~~~~~~~~FG~G~  379 (437)
                      +|++|++|+++...|++.+|+.++||.||||+.|+++.+.+|+||++|+||++|+||||++.+    ..+..|+|||+|+
T Consensus       308 ~E~lRl~p~~~~~~~~~~~~~~~~~~~ip~g~~v~~~~~~~~~d~~~~~dp~~F~PeRf~~~~~~~~~~~~~~~pFG~G~  387 (445)
T d2ciba1         308 KETLRLHPPLIILMRVAKGEFEVQGHRIHEGDLVAASPAISNRIPEDFPDPHDFVPARYEQPRQEDLLNRWTWIPFGAGR  387 (445)
T ss_dssp             HHHHHHSCSCCCEEEEECSCEEETTEEECTTCEEEECHHHHTTCTTTSSSTTSCCGGGGSTTTCHHHHCTTTCCTTCCGG
T ss_pred             ccccccccccceeccccccccccceeeccccccccccccccccCcccCCChhhCCcccccCccccccCCCCcccCCCCCC
Confidence            999999999999889999999999999999999999999999999999999999999999764    3567899999999


Q ss_pred             CCCccHHHHHHHHHHHHHHHHhhCceEeeCCCCCccc---ccccCCCCCccEEEeecc
Q 013728          380 RMCPGYEFERLLILVFIHNMIKRFKWDLLIPDEKFGY---DPMLSPSQGLPIRLQPHQ  434 (437)
Q Consensus       380 ~~C~G~~~a~~~~~~~l~~ll~~f~~~~~~~~~~~~~---~~~~~~~~~~~v~~~~r~  434 (437)
                      |.|||+++|..|++++++.|+++|||+++++.+....   ..+..|+.+++|+|+||+
T Consensus       388 r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~Rs  445 (445)
T d2ciba1         388 HRCVGAAFAIMQIKAIFSVLLREYEFEMAQPPESYRNDHSKMVVQLAQPAAVRYRRRT  445 (445)
T ss_dssp             GCCTTHHHHHHHHHHHHHHHHHHEEEEESSCGGGCCEECSSSSCEECSCCEEEEEEC-
T ss_pred             ccChhHHHHHHHHHHHHHHHHHhCEEEECCCCCccccccceEEEccCCCEEEEEEeCc
Confidence            9999999999999999999999999999876443332   335678899999999995
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure