Citrus Sinensis ID: 013743

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------

MNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIHDGKTLYNELEVVEGMKLDRGYISPYFITNQKNQKCELEDPLILVHEKKISNLTAVVRVLELALKRQRPLLIVAEDVESEALATLILNKLRAGIKVCAIKAPGFGENRKANMQDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELEKLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAPGGMGGMGGMGGMDY

ccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccccEEEEECccccccccccccccccccccEEEccccEEEEEccccHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHccEEEEcccccccccccccccccccEEEECcccEEEEcccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEECcccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc

MNAMDLRRGITMAVDAVVTNLKSRARMI***EEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIHDGKTLYNELEVVEGMKLDRGYISPYFITNQKNQKCELEDPLILVHEKKISNLTAVVRVLELALKRQRPLLIVAEDVESEALATLILNKLRAGIKVCAIKAPGFGENRKANMQDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDKKSIEERCEQIRSAIENSTSDYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELEKLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVE***********************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MNAMDLRRGITMAVDAVVTNLKSRARMISTSEEIAQVGTISANGEREIGELIAKAMEKVGKEGVITIHDGKTLYNELEVVEGMKLDRGYISPYFITNQKNQKCELEDPLILVHEKKISNLTAVVRVLELALKRQRPLLIVAEDVESEALATLILNKLRAGIKVCAIKAPGFGENRKANMQDLAVLTGGDLITEELGMDLEKVNLDMLGTCKKVTISKDDTVILDGAGDxxxxxxxxxxxxxxxxxxxxxYDKEKLQERLAKLSGGVAVLKIGGASEAEVGEKKDRVTDALNATKAAVEEGIVPGGGVALLYAAKELEKLSTANFDQKIGVQIIQNALKTPVHTIAANAGVEGAVVVGKLLEQDNTDLGYDAAKGEYVDMVKSGIIDPLKVIRTALVDAASVSSLMTTTEAIVVELPKEEKEAPGGMGGMGGMGGMDY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chaperonin CPN60, mitochondrial	Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.	confident	P29197
Chaperonin CPN60-2, mitochondrial	Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.	probable	Q05046
Chaperonin CPN60-1, mitochondrial	Implicated in mitochondrial protein import and macromolecular assembly. May facilitate the correct folding of imported proteins. May also prevent misfolding and promote the refolding and proper assembly of unfolded polypeptides generated under stress conditions in the mitochondrial matrix.	probable	Q05045

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IOK, chain A
Confidence level:very confident
Coverage over the Query: 1-122,134-145,163-188,204-416
View the alignment between query and template
View the model in PyMOL