Citrus Sinensis ID: 013769

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------

MATSATGQPQFIASTGGNRSFSNAPLIKNEDADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAFSGKSML

ccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHEECcccHHHHHccccccccccccHHHHHHHHHccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHEEcc

*******************************ADQIVVPDKTSWKNLFAYIGPGFLVSIAYIDPGNFETDLQSGAQYKYELLWIILVASCAALIIQSLAANLGVVTGKHLAEHCRNEYPKVPNFILWVLAEIAIVACDIPEVIGTAFALNMLFKIPVWIGVLLTGFSTLILLALQQYGVRKLEFLIAFLVFTMAGCFFAELGYAKPEAKEVLHGLFVPQLKGNGATGLAISLLGAMVMPHNLFLHSALVLSRKIPRSVRSIKEACRFYMIESGFALAVAFLINVSVISVSGAVCSSSNINPEDQASCKDLDLNKASFLLRNVLGSWSSKLFAIALLASGQSSTITGTYAGQYVMQGFLDLRLKPWLRNFLTRCLAIVPSLIVALIGGSAGAGQLIIIASMILSFELPFALVPLLKFTSSKVKMGMHANSIAFSGKSML

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Metal transporter Nramp6	Probable intracellular cadmium (Cd) transporter that participates in the distribution or availability of Cd within the cell.	probable	Q9S9N8
Metal transporter Nramp3	Probable metal transporter.	probable	Q653V6
Divalent metal cation transporter MntH	H(+)-stimulated, highly selective, manganese uptake system.	probable	Q8PKX1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JLN, chain A
Confidence level:probable
Coverage over the Query: 54-188
View the alignment between query and template
View the model in PyMOL

Template: 3GIA, chain A
Confidence level:probable
Coverage over the Query: 313-353
View the alignment between query and template
View the model in PyMOL