Citrus Sinensis ID: 013777

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MSTKFQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYGSSSWDDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
ccccccEEEEEEcccccEEEEcccccccccEEEEEEEcccEEEEEEccccEEEEEcccccccEEEEEccccccccEEEEEcccccccEEEEccccEEEEEcccEEEEEcccccccccccccccccccccccHHHHHHHHHcccccHHHHHHHHHHccccHHHHHHHHHccccEEEccccccccccccccccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHccccccEEEEEccccccccccccccccccccEEEEEEEccccccccccccccHHHHHHHHHHHcHHHHHHHHccccEEEEccccccccccccHHHHHHHHHHHHHHHHcccccEEEEcEEcccccccHHHHHHccccccc
ccccEEEEEEEccccccEEEEEccccccccEEEEEEEEccEEEEEEEccEEEEEEccccccEEEEEEcccccccEEEEEEccccccEEEEEcccccEEEEcccccEcEEEEEcccccccccHEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccEEEEEEEHHEEEcccccccccccHHHHHHHHHHHHHHcccEEEEEEEEccccccccHHHccccccccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccEEEEEccccccccccccccccccccEEEEEEEEEEEccHHHcccHHHHHHHHHHcHHHHHccccccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHccccccc
MSTKFQKYIAAESGGGTIVVANrtsasgweTFRLWRVNETFYNFRVNnkqfiglenqgqgnglvavsntagyseTFQIVRkdgdssrvrlsasnGMFIQAISETrltadygssswddsdpsvfkLNIVSTLRgeyqitngfgpdkapqvlqdhwdsyitdedfkflssnginavripvgwwiandptppkpfvggsskVLDNAFDWAEKYGVKVIVDlhaapgsqngnehsatrdgfqewgdsnvaDTVAVIDFLAARYANRPSLAAIELineplapgvaldTLKSYYKAGYDAVRKYTSTAYVIMsnrlgpadhKELLSFASGLSRVVIDVHYYNlfsnnfnglnvqqnidyvnnqrasdlgavttsngpltfvgewtcewnvkdaskqDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
MSTKFQKYIaaesgggtivvANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYgssswddsdpsVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
MSTKFQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYGSSSWDDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
*******YIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVR*************NGMFIQAISETRLTADYG***W***DPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHA****************FQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIK**
****FQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLV****************K**DS*RVRLSASNGMFIQAISETRLTADYGSSSWDDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
MSTKFQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYGSSSWDDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQ*********DGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
**TKFQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYGSSSWDDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTKFQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQGNGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYGSSSWDDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEANHWSLKWMIENGYIKLV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query436 2.2.26 [Sep-21-2011]
Q7Z9L3405 Glucan 1,3-beta-glucosida yes no 0.694 0.748 0.321 4e-39
B8N151405 Probable glucan 1,3-beta- N/A no 0.694 0.748 0.321 4e-39
Q12700425 Glucan 1,3-beta-glucosida N/A no 0.674 0.691 0.325 2e-38
Q12725421 Glucan 1,3-beta-glucosida yes no 0.697 0.722 0.300 2e-38
B0XN12416 Probable glucan 1,3-beta- N/A no 0.685 0.718 0.335 3e-37
Q4WK60416 Probable glucan 1,3-beta- yes no 0.685 0.718 0.335 4e-37
P29717438 Glucan 1,3-beta-glucosida N/A no 0.665 0.662 0.308 4e-37
A1D4Q5416 Probable glucan 1,3-beta- N/A no 0.699 0.733 0.355 4e-37
Q96V64426 Glucan 1,3-beta-glucosida N/A no 0.658 0.673 0.336 9e-37
A1CRV0415 Probable glucan 1,3-beta- N/A no 0.816 0.857 0.323 1e-36
>sp|Q7Z9L3|EXGA_ASPOR Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=exgA PE=1 SV=1 Back     alignment and function desciption
 Score =  162 bits (410), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 113/352 (32%), Positives = 166/352 (47%), Gaps = 49/352 (13%)

Query: 120 PSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVG 179
           PS+F       +  E+ +T   G ++A   L  HW S+++  DF+ ++  G+N VRIP+G
Sbjct: 48  PSIFDAAGAEAVD-EWSLTKILGKEEAEARLSAHWKSFVSAGDFQRMADAGLNHVRIPIG 106

Query: 180 WWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQE 239
           +W A  P    P+V G  + LD A +WA   G+KV++DLH APGSQNG ++S  R   Q 
Sbjct: 107 YW-ALGPLEGDPYVDGQLEYLDKAVEWAGAAGLKVLIDLHGAPGSQNGFDNSGRRGAIQW 165

Query: 240 WGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAP-GVALDTLKSYYKAGYDAVRKY 298
                V  T+   D LA RY    ++AAIE INEP  P GV    L+ YY + Y  V KY
Sbjct: 166 QQGDTVEQTLDAFDLLAERYLGSDTVAAIEAINEPNIPGGVDQGKLQEYYGSVYGIVNKY 225

Query: 299 TSTAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQR 358
            +   V+  +   P +      F +  S+VV+D H+Y++F N    +++  +ID V    
Sbjct: 226 NAGTSVVYGDGFLPVESWN--GFKTEGSKVVMDTHHYHMFDNGLIAMDIDSHIDAVCQFA 283

Query: 359 ASDLGAVTTSNGPLTFVGEWT-------------------------------CE------ 381
              L A   S+ P+  VGEWT                               C       
Sbjct: 284 HQHLEA---SDKPV-IVGEWTGAVTDCAKYLNGKGNGARYDGSYAADKAIGDCSSLATGF 339

Query: 382 -WNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCE-ANHWSLKWMIENG 431
              + D  + D +RF  AQLD +   + GW +W  K E A  W +  ++E G
Sbjct: 340 VSKLSDEERSDMRRFIEAQLDAFELKS-GWVFWTWKTEGAPGWDMSDLLEAG 390
Beta-glucanases participate in the metabolism of beta-glucan, the main structural component of the cell wall. It could also function biosynthetically as a transglycosylase.
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (taxid: 510516)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 8
>sp|B8N151|EXGA_ASPFN Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q12700|EXG_SCHOC Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis PE=3 SV=1 Back     alignment and function description
>sp|Q12725|EXG_YARLI Glucan 1,3-beta-glucosidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EXG1 PE=3 SV=2 Back     alignment and function description
>sp|B0XN12|EXGA_ASPFC Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q4WK60|EXGA_ASPFU Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|P29717|EXG_CANAL Glucan 1,3-beta-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=XOG1 PE=1 SV=4 Back     alignment and function description
>sp|A1D4Q5|EXGA_NEOFI Probable glucan 1,3-beta-glucosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=exgA PE=3 SV=1 Back     alignment and function description
>sp|Q96V64|EXG_BLUGR Glucan 1,3-beta-glucosidase OS=Blumeria graminis PE=3 SV=1 Back     alignment and function description
>sp|A1CRV0|EXGA_ASPCL Probable glucan 1,3-beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=exgA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
359497371529 PREDICTED: probable glucan 1,3-beta-gluc 0.997 0.822 0.759 0.0
296086866 537 unnamed protein product [Vitis vinifera] 0.995 0.808 0.756 0.0
147795863 610 hypothetical protein VITISV_000586 [Viti 0.981 0.701 0.740 0.0
224093776455 predicted protein [Populus trichocarpa] 0.986 0.945 0.732 0.0
296086868486 unnamed protein product [Vitis vinifera] 0.951 0.853 0.764 0.0
224081170481 predicted protein [Populus trichocarpa] 0.986 0.893 0.705 0.0
356511109503 PREDICTED: probable glucan 1,3-beta-gluc 0.990 0.858 0.679 1e-178
357455947497 Glucan 1,3-beta-glucosidase [Medicago tr 0.986 0.865 0.685 1e-175
357455945491 Glucan 1,3-beta-glucosidase [Medicago tr 0.986 0.875 0.668 1e-174
356525499502 PREDICTED: probable glucan 1,3-beta-gluc 0.990 0.860 0.675 1e-174
>gi|359497371|ref|XP_003635494.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Vitis vinifera] gi|296080899|emb|CBI18831.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/436 (75%), Positives = 381/436 (87%), Gaps = 1/436 (0%)

Query: 1   MSTKFQKYIAAESGGGTIVVANRTSASGWETFRLWRVNETFYNFRVNNKQFIGLENQGQG 60
           MSTK QKY++AE+GGGT VVANRTS+SGWETFRLWR+NE+ +N RV NKQF GLENQG+G
Sbjct: 72  MSTKLQKYLSAENGGGTDVVANRTSSSGWETFRLWRINESTFNLRVFNKQFFGLENQGKG 131

Query: 61  NGLVAVSNTAGYSETFQIVRKDGDSSRVRLSASNGMFIQAISETRLTADYGSSSWDDSDP 120
           N +VAV N+ G SETFQIVRK+ D +RVR+ ASNG+F+QA     +TADYG S WDD++P
Sbjct: 132 NKVVAVLNSPGNSETFQIVRKNDDRNRVRIKASNGLFLQA-KPGLVTADYGGSGWDDNNP 190

Query: 121 SVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGW 180
           SVF + IV TL+GEYQITNG+GPD+APQV+QDHW++YIT+EDF+FLSSNG+NAVRIPVGW
Sbjct: 191 SVFHMKIVRTLQGEYQITNGYGPDRAPQVMQDHWNAYITNEDFRFLSSNGLNAVRIPVGW 250

Query: 181 WIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEW 240
           WIA+DPTPPKPFVGGS K LDNAF WA+  G+K+IVDLHA  GSQNGN+HS TRDGFQEW
Sbjct: 251 WIASDPTPPKPFVGGSLKALDNAFTWAQNNGMKIIVDLHAVQGSQNGNDHSGTRDGFQEW 310

Query: 241 GDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTS 300
           GDSN+ DTVAVIDFLAARYAN PSLAAIEL+NEPLAPGV L+ LK YYKAGYDAVRKYTS
Sbjct: 311 GDSNIQDTVAVIDFLAARYANNPSLAAIELMNEPLAPGVTLNDLKKYYKAGYDAVRKYTS 370

Query: 301 TAYVIMSNRLGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRAS 360
            AYVI+SNRLGPAD KELL FA  L+RVVIDVHYY+LFS+ FN +NVQQNID++ NQRAS
Sbjct: 371 NAYVILSNRLGPADSKELLDFARSLNRVVIDVHYYSLFSDMFNNMNVQQNIDFIYNQRAS 430

Query: 361 DLGAVTTSNGPLTFVGEWTCEWNVKDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEAN 420
           DL AVTTSNGPL+FVGEWT EW    A K+DYQRFA AQ+DVYGRATFGWAYWA++C  N
Sbjct: 431 DLSAVTTSNGPLSFVGEWTAEWAKSGAPKEDYQRFAKAQIDVYGRATFGWAYWAYRCAQN 490

Query: 421 HWSLKWMIENGYIKLV 436
           HWSL+WMIENGYI L+
Sbjct: 491 HWSLEWMIENGYINLL 506

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|296086866|emb|CBI33033.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147795863|emb|CAN74231.1| hypothetical protein VITISV_000586 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224093776|ref|XP_002309987.1| predicted protein [Populus trichocarpa] gi|222852890|gb|EEE90437.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|296086868|emb|CBI33035.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|224081170|ref|XP_002306319.1| predicted protein [Populus trichocarpa] gi|222855768|gb|EEE93315.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356511109|ref|XP_003524272.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Glycine max] Back     alignment and taxonomy information
>gi|357455947|ref|XP_003598254.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355487302|gb|AES68505.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|357455945|ref|XP_003598253.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] gi|355487301|gb|AES68504.1| Glucan 1,3-beta-glucosidase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356525499|ref|XP_003531362.1| PREDICTED: probable glucan 1,3-beta-glucosidase A-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query436
ASPGD|ASPL0000016384405 exgC [Emericella nidulans (tax 0.536 0.577 0.376 2e-43
CGD|CAL0006153438 XOG1 [Candida albicans (taxid: 0.509 0.506 0.361 2.5e-43
UNIPROTKB|P29717438 XOG1 "Glucan 1,3-beta-glucosid 0.509 0.506 0.361 2.5e-43
SGD|S000005716445 SPR1 "Sporulation-specific exo 0.470 0.460 0.352 5.7e-38
POMBASE|SPBC1105.05407 exg1 "glucan 1,6-beta-glucosid 0.548 0.587 0.312 4.4e-34
CGD|CAL0006050479 EXG2 [Candida albicans (taxid: 0.369 0.336 0.339 9.8e-31
UNIPROTKB|Q5AIA1479 EXG2 "Putative uncharacterized 0.369 0.336 0.339 9.8e-31
SGD|S000004291448 EXG1 "Major exo-1,3-beta-gluca 0.548 0.533 0.333 1.1e-30
CGD|CAL0006247 525 SPR1 [Candida albicans (taxid: 0.538 0.447 0.276 2e-25
UNIPROTKB|Q59Z61 525 SPR1 "Putative uncharacterized 0.538 0.447 0.276 2e-25
ASPGD|ASPL0000016384 exgC [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
 Score = 402 (146.6 bits), Expect = 2.0e-43, Sum P(2) = 2.0e-43
 Identities = 95/252 (37%), Positives = 146/252 (57%)

Query:   134 EYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFV 193
             EY +T   G ++A   L +HW+++IT+EDF  ++  G+N VRIP+G+W A  P   +P+V
Sbjct:    59 EYTLTEVLGVEEAAARLSEHWNTFITEEDFALIAEAGLNYVRIPIGYWAAA-PLDGEPYV 117

Query:   194 GGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRD--GFQEWGDSNVADTVAV 251
              G  + LDNA  WA  + +KVIVDLH APGSQNG ++S  R   G+Q+ GD+ V  T+  
Sbjct:   118 SGQLEHLDNAVAWARAHNLKVIVDLHGAPGSQNGFDNSGRRGPIGWQQ-GDT-VEQTILA 175

Query:   252 IDFLAARY-ANRPSLAAIELINEPLAPG-VALDTLKSYYKAGYDAVRKYTSTAYVIMSNR 309
              + LA RY A+  ++  IE +NEP  PG +  D LK YY+     VRK +  A +++ + 
Sbjct:   176 FETLAQRYLADDDTVTMIEALNEPHVPGGINQDQLKDYYEETLARVRKNSPEATLLLHD- 234

Query:   310 LGPADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGA--VTT 367
              G    +    F +G   V++D H+Y +F    N  +++++ID      A  LG   +  
Sbjct:   235 -GFVQTEGWNGFMTG-ENVMMDTHHYEVFEGGQNAWSIEKHID-----AACQLGRQHLQA 287

Query:   368 SNGPLTFVGEWT 379
             ++ P+  VGEWT
Sbjct:   288 ADKPV-IVGEWT 298
GO:0004338 "glucan exo-1,3-beta-glucosidase activity" evidence=IEA;RCA
GO:0044042 "glucan metabolic process" evidence=RCA
GO:0009277 "fungal-type cell wall" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
GO:0046557 "glucan endo-1,6-beta-glucosidase activity" evidence=IEA
GO:0043169 "cation binding" evidence=IEA
GO:0006073 "cellular glucan metabolic process" evidence=IEA
CGD|CAL0006153 XOG1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|P29717 XOG1 "Glucan 1,3-beta-glucosidase" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000005716 SPR1 "Sporulation-specific exo-1,3-beta-glucanase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
POMBASE|SPBC1105.05 exg1 "glucan 1,6-beta-glucosidase Exg1" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0006050 EXG2 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q5AIA1 EXG2 "Putative uncharacterized protein EXG2" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
SGD|S000004291 EXG1 "Major exo-1,3-beta-glucanase of the cell wall" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
CGD|CAL0006247 SPR1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q59Z61 SPR1 "Putative uncharacterized protein SPR1" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.2.1LOW CONFIDENCE prediction!
3rd Layer3.2.1.58LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
estExt_Genewise1_v1.C_LG_VII1905
hypothetical protein (455 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
COG2730407 COG2730, BglC, Endoglucanase [Carbohydrate transpo 1e-31
pfam00150269 pfam00150, Cellulase, Cellulase (glycosyl hydrolas 5e-17
cd00257119 cd00257, Fascin, Fascin-like domain; members inclu 8e-04
>gnl|CDD|225344 COG2730, BglC, Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information 
 Score =  124 bits (313), Expect = 1e-31
 Identities = 86/354 (24%), Positives = 136/354 (38%), Gaps = 42/354 (11%)

Query: 116 DDSDPSVFKLNIVSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVR 175
            D             L G        G   A  +L+ HW ++IT+EDF  + S G NAVR
Sbjct: 32  ADGLFKTDPKESPGQLVGVSWFGLNLGNHLAQGLLESHWGNFITEEDFDQIKSAGFNAVR 91

Query: 176 IPVGWWIANDPTPPKPFV--GGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSAT 233
           IP+G+W         P++      K+LD A +WA+K G+ V++DLH  PG  NG+EHS  
Sbjct: 92  IPIGYWALQATDGDNPYLIGLTQLKILDEAINWAKKLGIYVLIDLHGYPGGNNGHEHSGY 151

Query: 234 RDGFQEWGDSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVALDTLKSYYKAGYD 293
              + +  + NV  T+ +  F+A R+ N  ++   ELINEP     + +T        YD
Sbjct: 152 TSDY-KEENENVEATIDIWKFIANRFKNYDTVIGFELINEPNGIVTS-ETWNGGDDEAYD 209

Query: 294 AVRKYTSTAYVIMSNRLGPAD--HKELLSFAS-GLSRVVIDVHYYNLFSNNFNGLNVQQN 350
            VR    +       R+G        ++   + G S    D   Y +  ++         
Sbjct: 210 VVRNAILSNAPHWLIRVGGQGLNGWRVIMAHTYGSSDGGNDNGVYIVPVDDPGLTAN--K 267

Query: 351 IDYVNNQRASD--------------------------LGAVTTSNGPLTFVGEWTCEWNV 384
             Y  +    D                          +G     NG  T +GE+   +N 
Sbjct: 268 HLYAPHVYGDDVLNGGSWTVGGEFDLAETDCAIWLNYVGHGARKNGYPTVIGEFGGNYNA 327

Query: 385 -----KDASKQDYQRFANAQLDVYGRATFGWAYWAHKCEAN-HWSLKWMIENGY 432
                +D  K + + +   QLDV+   T  W         +  + ++  I  G 
Sbjct: 328 NNPNPQDERKDNVKVYLENQLDVFDT-TTYWINNPWSGGNDTGYDIEDDINLGL 380

Length = 407
>gnl|CDD|215751 pfam00150, Cellulase, Cellulase (glycosyl hydrolase family 5) Back     alignment and domain information
>gnl|CDD|238160 cd00257, Fascin, Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 436
PF00150281 Cellulase: Cellulase (glycosyl hydrolase family 5) 100.0
COG2730407 BglC Endoglucanase [Carbohydrate transport and met 99.96
cd00257119 Fascin Fascin-like domain; members include actin-b 99.75
PF07745332 Glyco_hydro_53: Glycosyl hydrolase family 53; Inte 99.62
PF06268111 Fascin: Fascin domain; InterPro: IPR022768 This fa 99.57
PF02449374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 99.49
COG3867403 Arabinogalactan endo-1,4-beta-galactosidase [Carbo 99.43
PRK10150604 beta-D-glucuronidase; Provisional 99.38
TIGR03356427 BGL beta-galactosidase. 99.33
COG3934 587 Endo-beta-mannanase [Carbohydrate transport and me 99.13
PF02836298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 99.09
cd00257119 Fascin Fascin-like domain; members include actin-b 99.09
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 98.98
PRK09852 474 cryptic 6-phospho-beta-glucosidase; Provisional 98.97
COG2723 460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 98.96
PF06268111 Fascin: Fascin domain; InterPro: IPR022768 This fa 98.94
PRK15014 477 6-phospho-beta-glucosidase BglA; Provisional 98.92
TIGR01233 467 lacG 6-phospho-beta-galactosidase. This enzyme is 98.87
PF01229 486 Glyco_hydro_39: Glycosyl hydrolases family 39; Int 98.85
PRK13511 469 6-phospho-beta-galactosidase; Provisional 98.79
PF00232 455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 98.77
PRK09593 478 arb 6-phospho-beta-glucosidase; Reviewed 98.76
PRK09589 476 celA 6-phospho-beta-glucosidase; Reviewed 98.75
PF06229191 FRG1: FRG1-like family; InterPro: IPR010414 This e 98.73
PLN02849 503 beta-glucosidase 98.72
PLN02814 504 beta-glucosidase 98.71
PLN02998 497 beta-glucosidase 98.71
PF1287688 Cellulase-like: Sugar-binding cellulase-like; Inte 98.61
PRK09525 1027 lacZ beta-D-galactosidase; Reviewed 98.59
PF06229191 FRG1: FRG1-like family; InterPro: IPR010414 This e 98.56
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 98.53
PF03198314 Glyco_hydro_72: Glucanosyltransferase; InterPro: I 98.52
PF13204289 DUF4038: Protein of unknown function (DUF4038); PD 98.46
PF01301319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 98.41
PF14488166 DUF4434: Domain of unknown function (DUF4434) 98.32
PF00331320 Glyco_hydro_10: Glycosyl hydrolase family 10; Inte 98.15
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 97.99
PF14587384 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; P 97.83
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 97.82
KOG0626 524 consensus Beta-glucosidase, lactase phlorizinhydro 97.76
PF02055496 Glyco_hydro_30: O-Glycosyl hydrolase family 30; In 97.71
PLN03059 840 beta-galactosidase; Provisional 97.57
COG3250 808 LacZ Beta-galactosidase/beta-glucuronidase [Carboh 97.31
PF11790239 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; 97.27
COG5309305 Exo-beta-1,3-glucanase [Carbohydrate transport and 97.16
PF04601142 DUF569: Protein of unknown function (DUF569); Inte 96.96
COG5520 433 O-Glycosyl hydrolase [Cell envelope biogenesis, ou 96.88
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 96.54
PRK12313 633 glycogen branching enzyme; Provisional 96.45
PLN02447 758 1,4-alpha-glucan-branching enzyme 96.29
KOG2233 666 consensus Alpha-N-acetylglucosaminidase [Intracell 96.29
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 96.17
smart00642166 Aamy Alpha-amylase domain. 96.14
PF03662319 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-t 96.12
PRK05402 726 glycogen branching enzyme; Provisional 96.1
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 95.9
PLN02960 897 alpha-amylase 95.73
PRK10785 598 maltodextrin glucosidase; Provisional 95.69
COG1523 697 PulA Type II secretory pathway, pullulanase PulA a 95.64
PF05089333 NAGLU: Alpha-N-acetylglucosaminidase (NAGLU) tim-b 95.6
KOG3962246 consensus Predicted actin-bundling protein [Cytosk 95.41
PLN02877 970 alpha-amylase/limit dextrinase 95.35
PLN02161 531 beta-amylase 95.34
PF13200316 DUF4015: Putative glycosyl hydrolase domain 95.23
TIGR02102 1111 pullulan_Gpos pullulanase, extracellular, Gram-pos 95.23
PRK14705 1224 glycogen branching enzyme; Provisional 95.2
PF00128316 Alpha-amylase: Alpha amylase, catalytic domain; In 95.02
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 95.0
PLN02803 548 beta-amylase 94.98
PRK12568 730 glycogen branching enzyme; Provisional 94.89
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 94.61
PLN02801 517 beta-amylase 94.52
PLN00197 573 beta-amylase; Provisional 94.44
PF07468153 Agglutinin: Agglutinin; InterPro: IPR008998 Agglut 94.14
PLN02705 681 beta-amylase 94.02
PLN02905 702 beta-amylase 93.97
PRK14706 639 glycogen branching enzyme; Provisional 93.95
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 93.95
KOG2230 867 consensus Predicted beta-mannosidase [Carbohydrate 93.91
PLN00196428 alpha-amylase; Provisional 93.4
KOG0496 649 consensus Beta-galactosidase [Carbohydrate transpo 93.24
PF01373 402 Glyco_hydro_14: Glycosyl hydrolase family 14; Inte 93.11
PF02638311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 93.06
PLN02361401 alpha-amylase 92.99
PF01120346 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR00 92.4
PF14200105 RicinB_lectin_2: Ricin-type beta-trefoil lectin do 92.31
PF12891239 Glyco_hydro_44: Glycoside hydrolase family 44; Int 92.29
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 92.05
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 91.96
COG3623287 SgaU Putative L-xylulose-5-phosphate 3-epimerase [ 91.85
PRK03705 658 glycogen debranching enzyme; Provisional 91.82
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 91.8
TIGR02103 898 pullul_strch alpha-1,6-glucosidases, pullulanase-t 91.58
PRK07379400 coproporphyrinogen III oxidase; Provisional 91.53
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 91.39
PRK05628375 coproporphyrinogen III oxidase; Validated 91.04
PRK05904353 coproporphyrinogen III oxidase; Provisional 90.76
PRK08208430 coproporphyrinogen III oxidase; Validated 90.71
PRK06294370 coproporphyrinogen III oxidase; Provisional 90.5
PRK09505 683 malS alpha-amylase; Reviewed 90.08
PRK08599377 coproporphyrinogen III oxidase; Provisional 89.86
cd02742303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 89.75
PRK05799374 coproporphyrinogen III oxidase; Provisional 89.63
PF04601142 DUF569: Protein of unknown function (DUF569); Inte 89.52
PRK13347453 coproporphyrinogen III oxidase; Provisional 89.43
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 89.3
PF00167122 FGF: Fibroblast growth factor; InterPro: IPR002348 89.2
PRK09058449 coproporphyrinogen III oxidase; Provisional 89.12
PLN02784894 alpha-amylase 88.95
COG0635416 HemN Coproporphyrinogen III oxidase and related Fe 88.9
PRK05660378 HemN family oxidoreductase; Provisional 88.8
TIGR00539360 hemN_rel putative oxygen-independent coproporphyri 88.73
PRK09249453 coproporphyrinogen III oxidase; Provisional 87.77
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 87.76
KOG0470 757 consensus 1,4-alpha-glucan branching enzyme/starch 87.61
PRK09057380 coproporphyrinogen III oxidase; Provisional 87.38
PRK08446350 coproporphyrinogen III oxidase; Provisional 87.25
COG0366 505 AmyA Glycosidases [Carbohydrate transport and meta 87.15
TIGR01212302 radical SAM protein, TIGR01212 family. This unchar 87.1
KOG2566518 consensus Beta-glucocerebrosidase [Carbohydrate tr 86.96
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 86.85
cd06565301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 85.95
cd06564326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 85.88
PLN03244 872 alpha-amylase; Provisional 85.79
PRK06582390 coproporphyrinogen III oxidase; Provisional 85.72
cd06568329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 85.69
cd06562348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 84.57
PRK14511 879 maltooligosyl trehalose synthase; Provisional 84.12
PRK08207488 coproporphyrinogen III oxidase; Provisional 83.09
COG3589360 Uncharacterized conserved protein [Function unknow 81.24
cd06563357 GH20_chitobiase-like The chitobiase of Serratia ma 80.27
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information 
Probab=100.00  E-value=4.6e-35  Score=284.03  Aligned_cols=248  Identities=29%  Similarity=0.422  Sum_probs=174.9

Q ss_pred             CCHHHHHHHHhCCCCEEEecCccccccCCCCCCCCccchHHHHHHHHHHHHHcCCEEEEEcCCCCCCCCCCCCCCCCCCC
Q 013777          158 ITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFVGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGF  237 (436)
Q Consensus       158 ite~d~~~ia~~G~N~VRipv~~~~~~~~~~~~~~~~~~l~~ld~~v~~a~~~Gi~VilDlH~~pg~qng~~~sg~~~~~  237 (436)
                      +++++|+.|+++|+|+|||||.|..+.++.++..+.+..+++||++|++|+++||+||||+|..|+..++..        
T Consensus        22 ~~~~~~~~~~~~G~n~VRi~v~~~~~~~~~~~~~~~~~~~~~ld~~v~~a~~~gi~vild~h~~~~w~~~~~--------   93 (281)
T PF00150_consen   22 ITEADFDQLKALGFNTVRIPVGWEAYQEPNPGYNYDETYLARLDRIVDAAQAYGIYVILDLHNAPGWANGGD--------   93 (281)
T ss_dssp             SHHHHHHHHHHTTESEEEEEEESTSTSTTSTTTSBTHHHHHHHHHHHHHHHHTT-EEEEEEEESTTCSSSTS--------
T ss_pred             CHHHHHHHHHHCCCCEEEeCCCHHHhcCCCCCccccHHHHHHHHHHHHHHHhCCCeEEEEeccCcccccccc--------
Confidence            889999999999999999999986665555544566789999999999999999999999999865421111        


Q ss_pred             CCCC-hhHHHHHHHHHHHHHHHhCCCCceeEEEeecCCCCCCCC-------hhHHHHHHHHHHHHHHhhCCCeEEEEeCC
Q 013777          238 QEWG-DSNVADTVAVIDFLAARYANRPSLAAIELINEPLAPGVA-------LDTLKSYYKAGYDAVRKYTSTAYVIMSNR  309 (436)
Q Consensus       238 ~~w~-~~~~~~~~~~~~~lA~ry~~~~~v~g~eL~NEP~~~~~~-------~~~~~~~~~~~~~aIR~~~p~~~Viv~~~  309 (436)
                      .... +...+.+.++|+.||+||++++.+++|||+|||......       .+.+.+++++++++||+++|+++|++++.
T Consensus        94 ~~~~~~~~~~~~~~~~~~la~~y~~~~~v~~~el~NEP~~~~~~~~w~~~~~~~~~~~~~~~~~~Ir~~~~~~~i~~~~~  173 (281)
T PF00150_consen   94 GYGNNDTAQAWFKSFWRALAKRYKDNPPVVGWELWNEPNGGNDDANWNAQNPADWQDWYQRAIDAIRAADPNHLIIVGGG  173 (281)
T ss_dssp             TTTTHHHHHHHHHHHHHHHHHHHTTTTTTEEEESSSSGCSTTSTTTTSHHHTHHHHHHHHHHHHHHHHTTSSSEEEEEEH
T ss_pred             ccccchhhHHHHHhhhhhhccccCCCCcEEEEEecCCccccCCccccccccchhhhhHHHHHHHHHHhcCCcceeecCCC
Confidence            1111 345667788999999999999999999999999974332       37789999999999999999999999852


Q ss_pred             -CCCCChhh-hhccC-CCCCcEEEEEeecCcCCCCCCCC-ChhhhHHHHHHhhhhhHHHhhhcCCCeEEeecccccCCCC
Q 013777          310 -LGPADHKE-LLSFA-SGLSRVVIDVHYYNLFSNNFNGL-NVQQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVK  385 (436)
Q Consensus       310 -~~~~~~~~-~~~~~-~~~~nvv~~~H~Y~~~~~~~~~~-~~~~~i~~i~~~~~~~~~~~~~~~~p~v~vGEwg~~~~~~  385 (436)
                       |+ ..... ....+ ....+++|++|.|.++....... ........+........... ...+.|++|||||......
T Consensus       174 ~~~-~~~~~~~~~~P~~~~~~~~~~~H~Y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~g~pv~~gE~G~~~~~~  251 (281)
T PF00150_consen  174 GWG-ADPDGAAADNPNDADNNDVYSFHFYDPYDFSDQWNPGNWGDASALESSFRAALNWA-KKNGKPVVVGEFGWSNNDG  251 (281)
T ss_dssp             HHH-TBHHHHHHHSTTTTTTSEEEEEEEETTTCHHTTTSTCSHHHHHHHHHHHHHHHHHH-HHTTSEEEEEEEESSTTTS
T ss_pred             ccc-cccchhhhcCcccccCceeEEeeEeCCCCcCCccccccchhhhHHHHHHHHHHHHH-HHcCCeEEEeCcCCcCCCC
Confidence             33 22222 22232 24789999999999764211111 11111222222223333333 3445679999999863211


Q ss_pred             CcCHHHHHHHHHHHHHHHccCCCcEEEEceecCC
Q 013777          386 DASKQDYQRFANAQLDVYGRATFGWAYWAHKCEA  419 (436)
Q Consensus       386 ~~~~~~~~~~~~~q~~~~~~~~~Gw~~W~~k~~~  419 (436)
                      .    ...++..+.++.+++.++||+||+||.++
T Consensus       252 ~----~~~~~~~~~~~~~~~~~~g~~~W~~~~~~  281 (281)
T PF00150_consen  252 N----GSTDYADAWLDYLEQNGIGWIYWSWKPNS  281 (281)
T ss_dssp             C----HHHHHHHHHHHHHHHTTCEEEECEESSSS
T ss_pred             C----cCHHHHHHHHHHHHHCCCeEEEEecCCCC
Confidence            1    23344444477788889999999999863

2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 5 GH5 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); beta-mannanase (3.2.1.78 from EC); exo-1,3-glucanase (3.2.1.58 from EC); endo-1,6-glucanase (3.2.1.75 from EC); xylanase (3.2.1.8 from EC); endoglycoceramidase (3.2.1.123 from EC). The microbial degradation of cellulose and xylans requires several types of enzymes. Fungi and bacteria produces a spectrum of cellulolytic enzymes (cellulases) and xylanases which, on the basis of sequence similarities, can be classified into families. One of these families is known as the cellulase family A [] or as the glycosyl hydrolases family 5 []. One of the conserved regions in this family contains a conserved glutamic acid residue which is potentially involved [] in the catalytic mechanism.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 3NDY_A 3NDZ_B 1LF1_A 1TVP_B 1TVN_A 3AYR_A 3AYS_A 1QI0_A 1W3K_A 1OCQ_A ....
>COG2730 BglC Endoglucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF06268 Fascin: Fascin domain; InterPro: IPR022768 This family consists of several eukaryotic fascin or singed proteins Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG3867 Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>COG3934 Endo-beta-mannanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>cd00257 Fascin Fascin-like domain; members include actin-bundling/crosslinking proteins facsin, histoactophilin and singed; identified in sea urchin, Drosophila, Xenopus, rodents, and humans; The fascin-like domain adopts a beta-trefoil topology and contains an internal threefold repeat; the fascin subgroup contains four copies of the domain; Structurally similar to fibroblast growth factor (FGF) Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06268 Fascin: Fascin domain; InterPro: IPR022768 This family consists of several eukaryotic fascin or singed proteins Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PF01229 Glyco_hydro_39: Glycosyl hydrolases family 39; InterPro: IPR000514 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PF06229 FRG1: FRG1-like family; InterPro: IPR010414 This entry represents Frg1 (FSHD region gene 1), a protein that is considered to be a candidate for facioscapulohumeral muscular dystrophy (FSHD) Back     alignment and domain information
>PLN02849 beta-glucosidase Back     alignment and domain information
>PLN02814 beta-glucosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PF12876 Cellulase-like: Sugar-binding cellulase-like; InterPro: IPR024778 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09525 lacZ beta-D-galactosidase; Reviewed Back     alignment and domain information
>PF06229 FRG1: FRG1-like family; InterPro: IPR010414 This entry represents Frg1 (FSHD region gene 1), a protein that is considered to be a candidate for facioscapulohumeral muscular dystrophy (FSHD) Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PF03198 Glyco_hydro_72: Glucanosyltransferase; InterPro: IPR004886 This family is a group of yeast glycolipid proteins anchored to the membrane Back     alignment and domain information
>PF13204 DUF4038: Protein of unknown function (DUF4038); PDB: 3KZS_D Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PF00331 Glyco_hydro_10: Glycosyl hydrolase family 10; InterPro: IPR001000 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF14587 Glyco_hydr_30_2: O-Glycosyl hydrolase family 30; PDB: 3CLW_B Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02055 Glyco_hydro_30: O-Glycosyl hydrolase family 30; InterPro: IPR001139 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN03059 beta-galactosidase; Provisional Back     alignment and domain information
>COG3250 LacZ Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11790 Glyco_hydro_cc: Glycosyl hydrolase catalytic core; InterPro: IPR024655 This entry represents the glycosyl hydrolase catalytic core of a group of uncharacterised proteins Back     alignment and domain information
>COG5309 Exo-beta-1,3-glucanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins Back     alignment and domain information
>COG5520 O-Glycosyl hydrolase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>KOG2233 consensus Alpha-N-acetylglucosaminidase [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>PF03662 Glyco_hydro_79n: Glycosyl hydrolase family 79, N-terminal domain ; InterPro: IPR005199 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05089 NAGLU: Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain; InterPro: IPR024733 Alpha-N-acetylglucosaminidase is a lysosomal enzyme that is required for the stepwise degradation of heparan sulphate [] Back     alignment and domain information
>KOG3962 consensus Predicted actin-bundling protein [Cytoskeleton] Back     alignment and domain information
>PLN02877 alpha-amylase/limit dextrinase Back     alignment and domain information
>PLN02161 beta-amylase Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>PLN02803 beta-amylase Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>PLN02801 beta-amylase Back     alignment and domain information
>PLN00197 beta-amylase; Provisional Back     alignment and domain information
>PF07468 Agglutinin: Agglutinin; InterPro: IPR008998 Agglutinins are sugar-specific lectins that can agglutinate erythrocytes and other cell types Back     alignment and domain information
>PLN02705 beta-amylase Back     alignment and domain information
>PLN02905 beta-amylase Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>KOG2230 consensus Predicted beta-mannosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>KOG0496 consensus Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF01373 Glyco_hydro_14: Glycosyl hydrolase family 14; InterPro: IPR001554 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>PF01120 Alpha_L_fucos: Alpha-L-fucosidase; InterPro: IPR000933 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14200 RicinB_lectin_2: Ricin-type beta-trefoil lectin domain-like; PDB: 2X2S_C 2X2T_A 2VSE_B 2VSA_A 3EF2_A 2IHO_A 3HZB_H 1YBI_B 3PHZ_A 3NBE_A Back     alignment and domain information
>PF12891 Glyco_hydro_44: Glycoside hydrolase family 44; InterPro: IPR024745 This is a family of putative bacterial glycoside hydrolases Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>COG3623 SgaU Putative L-xylulose-5-phosphate 3-epimerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type Back     alignment and domain information
>PRK07379 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PRK05628 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK05904 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08208 coproporphyrinogen III oxidase; Validated Back     alignment and domain information
>PRK06294 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PRK08599 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PRK05799 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PF04601 DUF569: Protein of unknown function (DUF569); InterPro: IPR007679 This is a family of hypothetical proteins Back     alignment and domain information
>PRK13347 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>PF00167 FGF: Fibroblast growth factor; InterPro: IPR002348 The interleukin-1 (IL1) and heparin-binding growth factor (HBGF) families share low sequence similarity (about 25% []) but have very similar structures Back     alignment and domain information
>PRK09058 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>COG0635 HemN Coproporphyrinogen III oxidase and related Fe-S oxidoreductases [Coenzyme metabolism] Back     alignment and domain information
>PRK05660 HemN family oxidoreductase; Provisional Back     alignment and domain information
>TIGR00539 hemN_rel putative oxygen-independent coproporphyrinogen III oxidase Back     alignment and domain information
>PRK09249 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG0470 consensus 1,4-alpha-glucan branching enzyme/starch branching enzyme II [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09057 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>PRK08446 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01212 radical SAM protein, TIGR01212 family Back     alignment and domain information
>KOG2566 consensus Beta-glucocerebrosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>PLN03244 alpha-amylase; Provisional Back     alignment and domain information
>PRK06582 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PRK08207 coproporphyrinogen III oxidase; Provisional Back     alignment and domain information
>COG3589 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
1eqp_A394 Exo-B-(1,3)-Glucanase From Candida Albicans Length 4e-38
2pc8_A400 E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida 6e-38
2pbo_A400 E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida A 6e-38
2pb1_A400 Exo-b-(1,3)-glucanase From Candida Albicans In Comp 6e-38
1cz1_A394 Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 6e-38
3n9k_A399 F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase 1e-37
3o6a_A399 F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase 1e-37
2pf0_A400 F258i Mutant Of Exo-B-(1,3)-Glucanase From Candida 3e-37
1h4p_A408 Crystal Structure Of Exo-1,3-Beta Glucanse From Sac 3e-30
1cec_A343 A Common Protein Fold And Similar Active Site In Tw 4e-12
1cen_A343 Cellulase (Celc) Mutant With Glu 140 Replaced By Gl 9e-12
3mmu_A317 Crystal Structure Of Endoglucanase Cel5a From The H 7e-09
3azr_A317 Diverse Substrates Recognition Mechanism Revealed B 9e-09
3aof_A317 Crystal Structures Of Thermotoga Maritima Cel5a In 5e-08
3amg_A317 Crystal Structures Of Thermotoga Maritima Cel5a In 5e-08
1vjz_A341 Crystal Structure Of Endoglucanase (Tm1752) From Th 4e-06
>pdb|1EQP|A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans Length = 394 Back     alignment and structure 
Iteration: 1

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 105/340 (30%), Positives = 161/340 (47%), Gaps = 50/340 (14%)
Query: 134 EYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFV 193
           EY  T   G + A ++LQ HW ++IT++DFK +S+ G+N VRIP+G+W A       P+V
Sbjct: 45  EYHWTQTLGKEAASRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYW-AFQLLDNDPYV 103
Query: 194 GGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVID 253
            G  + L+ A  WA K  ++V +DLH APGSQNG ++S  RD +      N   T+ V++
Sbjct: 104 QGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLN 163
Query: 254 FLAARYANRP---SLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRL 310
            +  +Y        +  IEL+NEPL P + +D LK ++  GY+++R+  S   VI+ +  
Sbjct: 164 TIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAF 223
Query: 311 GPADH-KELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNN------------- 356
               +    L+ A G   VV+D H+Y +FS      N+  +I    N             
Sbjct: 224 QVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNV 283
Query: 357 ------------------------QRASDLGAVTTSNGPLTFVGEWTCEWNVKDASKQDY 392
                                   + A D      S  PL  + +W+      D  K D 
Sbjct: 284 AGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWS------DEHKTDT 337
Query: 393 QRFANAQLDVYGRATFGWAYWAHKCE-ANHWSLKWMIENG 431
           +R+  AQLD +   T GW +W+ K E A  WS + +  NG
Sbjct: 338 RRYIEAQLDAF-EYTGGWVFWSWKTENAPEWSFQTLTYNG 376
>pdb|2PC8|A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A Length = 400 Back     alignment and structure
>pdb|2PBO|A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Length = 400 Back     alignment and structure
>pdb|2PB1|A Chain A, Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Unhydrolysed And Covalently Linked 2,4-dinitrophenyl-2-deoxy-2- Fluoro-b-d-glucopyranoside At 1.9 A Length = 400 Back     alignment and structure
>pdb|1CZ1|A Chain A, Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A Resolution Length = 394 Back     alignment and structure
>pdb|3N9K|A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A Length = 399 Back     alignment and structure
>pdb|3O6A|A Chain A, F144yF258Y DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans At 2 A Length = 399 Back     alignment and structure
>pdb|2PF0|A Chain A, F258i Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.9 A Length = 400 Back     alignment and structure
>pdb|1H4P|A Chain A, Crystal Structure Of Exo-1,3-Beta Glucanse From Saccharomyces Cerevisiae Length = 408 Back     alignment and structure
>pdb|1CEC|A Chain A, A Common Protein Fold And Similar Active Site In Two Distinct Families Of Beta-Glycanases Length = 343 Back     alignment and structure
>pdb|1CEN|A Chain A, Cellulase (Celc) Mutant With Glu 140 Replaced By Gln Complexed With Cellohexaose Length = 343 Back     alignment and structure
>pdb|3MMU|A Chain A, Crystal Structure Of Endoglucanase Cel5a From The Hyperthermophilic Thermotoga Maritima Length = 317 Back     alignment and structure
>pdb|3AZR|A Chain A, Diverse Substrates Recognition Mechanism Revealed By Thermotoga Maritima Cel5a Structures In Complex With Cellobiose Length = 317 Back     alignment and structure
>pdb|3AOF|A Chain A, Crystal Structures Of Thermotoga Maritima Cel5a In Complex With Mannotriose Substrate Length = 317 Back     alignment and structure
>pdb|3AMG|A Chain A, Crystal Structures Of Thermotoga Maritima Cel5a In Complex With Cellobiose Substrate, Mutant Form Length = 317 Back     alignment and structure
>pdb|1VJZ|A Chain A, Crystal Structure Of Endoglucanase (Tm1752) From Thermotoga Maritima At 2.05 A Resolution Length = 341 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query436
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 1e-69
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 6e-67
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 1e-58
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 7e-53
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 2e-48
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 7e-41
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 4e-30
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 9e-30
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 4e-29
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 8e-29
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 8e-28
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 3e-26
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 4e-26
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 1e-25
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 4e-25
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 1e-23
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 2e-21
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 3e-21
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 8e-21
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 1e-20
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 1e-20
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 3e-20
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 1e-19
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 5e-19
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 3e-18
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 6e-18
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 3e-05
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 2e-17
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 3e-16
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 6e-16
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 2e-14
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 5e-13
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 1e-11
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 1e-05
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 4e-09
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 2e-07
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 2e-07
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 6e-06
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 4e-05
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 3e-04
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Length = 399 Back     alignment and structure
 Score =  225 bits (573), Expect = 1e-69
 Identities = 103/336 (30%), Positives = 158/336 (47%), Gaps = 38/336 (11%)

Query: 134 EYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFV 193
           EY  T   G + A ++LQ HW ++IT++DFK +S+ G+N VRIP+G+W A       P+V
Sbjct: 50  EYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYW-AFQLLDNDPYV 108

Query: 194 GGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVID 253
            G  + L+ A  WA K  ++V +DLH APGSQNG ++S  RD +      N   T+ V++
Sbjct: 109 QGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRDSYNFQNGDNTQVTLNVLN 168

Query: 254 FLAARYANRP---SLAAIELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRL 310
            +  +Y        +  IEL+NEPL P + +D LK ++  GY+++R+  S   VI+ +  
Sbjct: 169 TIFKKYGGNEYSDVVIGIELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAA 228

Query: 311 GPADH-KELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNNQRASDLGA----- 364
               +    L+ A G   VV+D H+Y +FS      N+  +I    N             
Sbjct: 229 QVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNINDHISVACNWGWDAKKESHWNV 288

Query: 365 VTTSNGPLTFVGEWTCEWNVK--------------------------DASKQDYQRFANA 398
             + +  LT   +W    N                            D  K D +R+  A
Sbjct: 289 AGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTDTRRYIEA 348

Query: 399 QLDVYGRATFGWAYWAHKCE-ANHWSLKWMIENGYI 433
           QLD +   T GW +W+ K E A  WS + +  NG  
Sbjct: 349 QLDAF-EYTGGWVFWSWKTENAPEWSFQTLTYNGLF 383
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Length = 408 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Length = 343 Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Length = 341 Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Length = 317 Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Length = 320 Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Length = 376 Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Length = 305 Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Length = 358 Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Length = 395 Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Length = 345 Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Length = 327 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Length = 306 Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Length = 340 Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Length = 303 Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Length = 302 Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Length = 380 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Length = 293 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Length = 458 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Length = 294 Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Length = 291 Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Length = 345 Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Length = 481 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Length = 364 Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* Length = 493 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Length = 464 Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Length = 353 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Length = 491 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Length = 344 Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Length = 155 Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Length = 155 Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Length = 399 Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Length = 373 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Length = 440 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Length = 334 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Length = 383 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Length = 645 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
3n9k_A399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 100.0
1h4p_A408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 100.0
1ceo_A343 Cellulase CELC; glycosyl hydrolase, family A/5 of 100.0
3ndz_A345 Endoglucanase D; cellotriose, xylanase, carbohydra 100.0
1vjz_A341 Endoglucanase; TM1752, structural genomics, JCSG, 100.0
3qho_A458 Endoglucanase, 458AA long hypothetical endo-1,4-be 100.0
1ece_A358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 100.0
3nco_A320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 100.0
1h1n_A305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 100.0
3l55_A353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 100.0
7a3h_A303 Endoglucanase; hydrolase, cellulose degradation, g 100.0
3ayr_A376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 100.0
3qr3_A340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 100.0
3aof_A317 Endoglucanase; glycosyl hydrolase family 5, cellul 100.0
3pzt_A327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 100.0
1g01_A364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 100.0
1edg_A380 Endoglucanase A; family A, cellulases, xylanases, 100.0
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 100.0
1tvn_A293 Cellulase, endoglucanase G; glycoside hydrolase, C 100.0
2whl_A294 Beta-mannanase, baman5; glycoside hydrolase, hydro 100.0
2osx_A481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 100.0
2jep_A395 Xyloglucanase; family 5, plant cell WALL, hydrolas 100.0
3jug_A345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 100.0
1bqc_A302 Protein (beta-mannanase); glycosyl hydrolase, fami 100.0
1egz_A291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 100.0
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 100.0
2cks_A306 Endoglucanase E-5; carbohydrate metabolism, polysa 100.0
4hty_A359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 100.0
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 99.97
1rh9_A373 Endo-beta-mannanase; endo-beta-mannase, retaining, 99.94
3pzg_A383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 99.93
1qnr_A344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 99.93
2c0h_A353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 99.93
1uuq_A440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 99.92
3vup_A351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 99.9
4awe_A387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 99.87
1hjs_A332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 99.83
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 99.82
1ur4_A399 Galactanase; hydrolase, beta-1, glycoside hydrolas 99.8
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 99.69
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 99.68
3llp_A493 Fascin; beta-trefoil, actin bundling protein, canc 99.68
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 99.66
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.6
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.59
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 99.58
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 99.58
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 99.52
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.52
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 99.5
3ahx_A 453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.5
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.48
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 99.47
1qox_A 449 Beta-glucosidase; hydrolase, cellulose degradation 99.46
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 99.44
3civ_A343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 99.42
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.42
3fn9_A 692 Putative beta-galactosidase; structural genomics, 99.4
1gnx_A 479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.38
3cmg_A 667 Putative beta-galactosidase; structural genomics, 99.37
4ekj_A 500 Beta-xylosidase; TIM-barrel fold, hemicellulase, h 99.37
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.36
2xhy_A 479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.33
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.32
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 99.32
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.3
3ta9_A 458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.26
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 99.23
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 99.21
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 99.19
1pbg_A 468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.16
2yug_A155 Protein FRG1; spliceosome, facioscapulohumeral mus 99.1
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 99.1
3d3a_A 612 Beta-galactosidase; protein structure initiative I 99.05
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 99.04
1uwi_A 489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.04
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 99.03
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 99.02
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.02
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 99.01
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 98.99
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 98.99
1v08_A 512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 98.97
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 98.96
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 98.95
1wcg_A 464 Thioglucosidase, myrosinase; aphid, beta-glucosida 98.91
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 98.9
2e9l_A 469 Cytosolic beta-glucosidase; novel cytosolic neutra 98.89
4b3l_A 479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 98.88
3gnp_A 488 OS03G0212800 protein; beta-alpha barrel, glycosida 98.87
2dga_A 565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 98.87
2je8_A 848 Beta-mannosidase; glycoside hydrolase, hydrolase; 98.86
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 98.86
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 98.86
1e4m_M 501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 98.86
3gm8_A 801 Glycoside hydrolase family 2, candidate beta-GLYC; 98.86
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 98.86
3f5l_A 481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 98.85
1cbg_A 490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 98.85
3bga_A 1010 Beta-galactosidase; NYSGXRC, protein structure ini 98.85
1v02_A 565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 98.84
2e3z_A 465 Beta-glucosidase; TIM barrel, glycoside hydrolase 98.84
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 98.83
2jf7_A 532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 98.82
2uwf_A356 Endoxylanase, alkaline active endoxylanase; hydrol 98.79
3vii_A 487 Beta-glucosidase; cellulases, glycosyl hydrolase, 98.78
1r85_A379 Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A 98.78
3qom_A 481 6-phospho-beta-glucosidase; structural genomics, P 98.78
3ahy_A 473 Beta-glucosidase; cellulases, glycosyl hydrolase, 98.77
4dde_A 480 6-phospho-beta-glucosidase; structural genomics, P 98.73
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 98.71
3ptm_A 505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 98.69
4atd_A 513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 98.68
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 98.65
3emz_A331 Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 ba 98.6
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 98.6
4a3y_A 540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 98.58
3kzs_A 463 Glycosyl hydrolase family 5; structural genomics, 98.56
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 98.56
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 98.54
2vzs_A 1032 CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, 98.5
1qw9_A 502 Arabinosidase, alpha-L-arabinofuranosidase; hydrol 98.49
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.47
2c7f_A 513 Alpha-L-arabinofuranosidase; glycosidase, xylan, a 98.43
2y2w_A 574 Arabinofuranosidase; hydrolase, arabinoxylan, glyc 98.33
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 98.19
2w5f_A540 Endo-1,4-beta-xylanase Y; cellulosome, glycosidase 98.16
3clw_A 507 Conserved exported protein; structural genomics, u 98.11
3ug3_A 504 Alpha-L-arabinofuranosidase; TIM barrel, hydrolase 98.1
3vny_A 488 Beta-glucuronidase; TIM barrel, greek-KEY, glycosi 98.09
2vrq_A 496 Alpha-L-arabinofuranosidase; hydrolase, glycosidas 98.04
4h41_A340 Putative alpha-L-fucosidase; hydrolase, carbohydra 97.98
2y24_A 383 Xylanase; hydrolase, GH5 family, aldotetraouronic 97.92
2nt0_A497 Glucosylceramidase; cerezyme, glucocerebrosidase, 97.9
2wnw_A447 Activated by transcription factor SSRB; hydrolase, 97.89
3gyc_A393 Putative glycoside hydrolase; YP_001304622.1, stru 97.84
3ro8_A341 Endo-1,4-beta-xylanase; glycosyl hydrolase family 97.49
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 96.91
3ur8_A323 Glucan endo-1,3-beta-D-glucosidase; glucoside hydr 96.87
1ghs_A306 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulg 96.79
4aw7_A 591 GH86A beta-porphyranase; hydrolase, porphyran-hexa 96.7
2cyg_A312 Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (be 96.52
1ea9_C583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 96.44
3kl0_A 401 Glucuronoxylanase XYNC; alpha beta barrel, (beta/a 96.42
1aq0_A306 1,3-1,4-beta-glucanase; hydrolase, glycosidase, gl 96.4
2yih_A 524 CEL44C, xyloglucanase; hydrolase, GH44, endo-gluca 96.24
3zr5_A 656 Galactocerebrosidase; hydrolase, GALC, glycosyl hy 96.18
2vx5_A396 Cellvibrio japonicus mannanase cjman26C; hydrolase 96.06
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 96.0
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 95.79
1jlx_A303 Agglutinin, amaranthin, ACA; complex (lectin/sacch 95.47
3em5_A316 Beta-1,3-glucanase; glycoprotein, rossmann fold, ( 95.43
1wdp_A 495 Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.2 95.33
1fa2_A 498 Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.3 95.24
2xfr_A 535 Beta-amylase; hydrolase, carbohydrate metabolism, 95.19
3ik2_A 517 Endoglucanase A; TIM-like barrel, hydrolase; 2.20A 95.14
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 95.02
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 94.87
3tp4_A 475 Computational design of enzyme; structural genomic 94.84
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 94.84
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 94.83
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 94.81
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 94.54
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 94.5
2e4t_A 519 Endoglucanase, xyloglucanase; TIM barrel, TIM-like 94.5
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 94.21
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 94.2
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 94.18
2v3g_A283 Endoglucanase H; beta-1 4 beta-1 3 glucanase, lich 94.1
3ii1_A 535 Cellulase; CELM2, glucanase-xyanase, glucanase, xy 93.89
1odz_A386 Mannanase A; hydrolase, family 26, glycoside-hydro 93.65
1ht6_A405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 93.62
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 93.61
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 93.53
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 93.52
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 93.5
4a4a_A 914 Alpha-N-acetylglucosaminidase family protein; hydr 93.46
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 93.42
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 93.28
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 93.18
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 93.11
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 93.09
1jlx_A303 Agglutinin, amaranthin, ACA; complex (lectin/sacch 92.98
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 92.97
3pg0_A165 Threefoil; symmetric design, beta-trefoil, enginee 92.95
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 92.89
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 92.8
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 92.71
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 92.39
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 92.31
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 92.14
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 92.03
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 91.92
2fhf_A 1083 Pullulanase; multiple domain, beta-alpha-barrel, a 91.91
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 91.88
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 91.87
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 91.85
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 91.81
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 91.76
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 91.73
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 91.63
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 91.59
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 91.58
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 91.41
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 91.32
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 91.14
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 91.04
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 91.0
4aio_A 884 Limit dextrinase; hydrolase, pullulanase, glycosid 90.98
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 90.91
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 90.72
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 90.49
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 90.37
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 90.33
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 90.18
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 89.88
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 89.66
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 89.53
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 88.95
1hcd_A118 Hisactophilin; actin binding; NMR {Dictyostelium d 88.83
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 88.59
2ddx_A333 Beta-1,3-xylanase; glycoside hydrolase, TIM barrel 88.57
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 88.51
3ues_A 478 Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydr 87.89
3klk_A1039 Glucansucrase; native form, open conformation, mul 87.57
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 87.04
4acy_A382 Endo-alpha-mannosidase; hydrolase, endomannosidase 87.02
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 86.48
3eyp_A 469 Putative alpha-L-fucosidase; structural genomics, 83.56
3hje_A 704 704AA long hypothetical glycosyltransferase; treha 83.09
3vsf_A526 Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactana 82.9
1olt_A457 Oxygen-independent coproporphyrinogen III oxidase; 82.23
4ad1_A380 Glycosyl hydrolase family 71; glycoside hydrolase 81.62
2k8e_A130 UPF0339 protein YEGP; protein structure initiative 81.4
3q7x_A132 De novo designed beta-trefoil architecture with S 81.15
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
Probab=100.00  E-value=1.2e-60  Score=483.41  Aligned_cols=310  Identities=33%  Similarity=0.588  Sum_probs=264.2

Q ss_pred             CCCcccccc-c----ccccccchhhhhccCcChhhHHHHHhhhhcCCHHHHHHHHhCCCCEEEecCccccccCCCCCCCC
Q 013777          118 SDPSVFKLN-I----VSTLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPF  192 (436)
Q Consensus       118 ~~ps~F~~~-~----~~~~~~e~~~~~~~G~~~a~~~~~~h~~~~ite~d~~~ia~~G~N~VRipv~~~~~~~~~~~~~~  192 (436)
                      ++||+|+.. +    .....+||++|+.+|.+++.+++++||++||||+||+.||++|||+|||||+||.+ ++.+.+||
T Consensus        29 itps~f~~~~~~~~~~~~~~dE~~l~~~lG~~~a~~~~~~hw~~~ite~D~~~ik~~G~N~VRipi~~~~~-~~~~~~py  107 (399)
T 3n9k_A           29 MTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAF-QLLDNDPY  107 (399)
T ss_dssp             TSGGGTGGGCBTTBCTTSCCSHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHTTCCEEEEEEEGGGT-CCCTTCCC
T ss_pred             cCchhhhcccCccccCcccccHHHHHHHhCHHHHHHHHHHhhcccCcHHHHHHHHHcCCCEEEEcccHHHc-cCCCCCcc
Confidence            678888754 2    22467999999999999999999999999999999999999999999999999976 44455688


Q ss_pred             ccchHHHHHHHHHHHHHcCCEEEEEcCCCCCCCCCCCCCCCCCCCCCCC-hhHHHHHHHHHHHHHHHhCCC---CceeEE
Q 013777          193 VGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWG-DSNVADTVAVIDFLAARYANR---PSLAAI  268 (436)
Q Consensus       193 ~~~~l~~ld~~v~~a~~~Gi~VilDlH~~pg~qng~~~sg~~~~~~~w~-~~~~~~~~~~~~~lA~ry~~~---~~v~g~  268 (436)
                      ..+.+++||++|++|+++||+||||||..||+||+++++|.. +...|. +.+.++++++|+.||+||+++   |.|++|
T Consensus       108 ~~~~~~~ld~vV~~a~~~Gl~VILDlH~~pG~qng~~~sG~~-~~~~w~~~~~~~~~~~~w~~iA~ry~~~~y~~~V~~~  186 (399)
T 3n9k_A          108 VQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLR-DSYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGI  186 (399)
T ss_dssp             CCCHHHHHHHHHHHHHHTTCEEEEEEEECTTCSSCCGGGSST-TCCCTTSTTHHHHHHHHHHHHHHHHSSGGGTTTEEEE
T ss_pred             chhHHHHHHHHHHHHHHCCCEEEEEecCCCcccccccCCCCC-CCCCCCCHHHHHHHHHHHHHHHHHhhcccCCCceEEE
Confidence            777999999999999999999999999999999999999876 345676 678999999999999999999   999999


Q ss_pred             EeecCCCCCCCChhHHHHHHHHHHHHHHhhCCCeEEEEeCCCCC-CChhhhhccCCCCCcEEEEEeecCcCCCCCCCCCh
Q 013777          269 ELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGP-ADHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNV  347 (436)
Q Consensus       269 eL~NEP~~~~~~~~~~~~~~~~~~~aIR~~~p~~~Viv~~~~~~-~~~~~~~~~~~~~~nvv~~~H~Y~~~~~~~~~~~~  347 (436)
                      ||+|||..+..+.+.|++||++++++||+++|+++|++++++.+ ..+..++.....++|+||++|+|.+|+.....++.
T Consensus       187 el~NEP~~~~~~~~~~~~~~~~a~~~IR~~~p~~~Iii~dg~~~~~~W~~~l~~~~~~~nvv~d~H~Y~~f~~~~~~~~~  266 (399)
T 3n9k_A          187 ELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAAQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNI  266 (399)
T ss_dssp             ESCSCCCGGGSCHHHHHHHHHHHHHHHHHTTCCCCEEEECTTCCTTTTTTSSCGGGTCCSEEEEEECCSCSSHHHHTSCH
T ss_pred             EeccCCCCCCCCHHHHHHHHHHHHHHHHhcCCCCeEEEeCCCCChHHHHhhcccccCCCCEEEEeccccCCCcccccCCH
Confidence            99999997556788999999999999999999999999988764 34555655434679999999999999866667889


Q ss_pred             hhhHHHHHHhhhhhHHHhhhcCCCeEEeecccccCCCC------------------------------------CcCHHH
Q 013777          348 QQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWNVK------------------------------------DASKQD  391 (436)
Q Consensus       348 ~~~i~~i~~~~~~~~~~~~~~~~p~v~vGEwg~~~~~~------------------------------------~~~~~~  391 (436)
                      +++++.+|... .   .+.+. ..|+|||||+++...+                                    ...++.
T Consensus       267 ~~~i~~~c~~~-~---~~~~~-~~~~ivGEwS~a~~dc~~~lng~~~g~r~~gt~~~~~~~g~c~~~~~~~~~~~~~k~~  341 (399)
T 3n9k_A          267 NDHISVACNWG-W---DAKKE-SHWNVAGSWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTD  341 (399)
T ss_dssp             HHHHHHHHHHH-H---HHHTC-SSEEEEEECCSCSSSCSTTTTCTTCCCTTBTCSTTCCBCCCSGGGSSGGGCCHHHHHH
T ss_pred             HHHHHHHHHHH-H---HHhcC-CCCEEEEecccccccchhhccCCCccccccccCCCCCcCCcCcCcCccccccHHHHHH
Confidence            99999998743 2   22333 3569999999875311                                    012467


Q ss_pred             HHHHHHHHHHHHccCCCcEEEEceecCC-CCCChHHHHhCCCccc
Q 013777          392 YQRFANAQLDVYGRATFGWAYWAHKCEA-NHWSLKWMIENGYIKL  435 (436)
Q Consensus       392 ~~~~~~~q~~~~~~~~~Gw~~W~~k~~~-~~Ws~~~~~~~g~~~~  435 (436)
                      +++|+++|+++|++ +.||+|||||+++ ++|||+.++++|+||.
T Consensus       342 ~~~f~~aQ~~~~e~-~~Gw~fWtwK~e~~~~W~~~~~~~~g~~p~  385 (399)
T 3n9k_A          342 TRRYIEAQLDAFEY-TGGWVFWSWKTENAPEWSFQTLTYNGLFPQ  385 (399)
T ss_dssp             HHHHHHHHHHHHHT-TTEEEESCSCCSSCGGGCHHHHHHTTCSCS
T ss_pred             HHHHHHHHHHHHHc-CCcEEEeeeecCCCCCCCHHHHHhCCCcCC
Confidence            89999999999996 5599999999996 8999999999999985
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* 4gov_A 4goy_A 4gp3_A 4gp0_A* Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3llp_A Fascin; beta-trefoil, actin bundling protein, cancer, metastasis, CE migration, acetylation, actin-binding, cytoplasm, phosphopr protein binding; HET: EPE; 1.80A {Homo sapiens} PDB: 1dfc_A* 3lna_A* 3o8k_A* 3p53_A* 4gov_A 4goy_A 4gp3_A 4gp0_A* Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>4ekj_A Beta-xylosidase; TIM-barrel fold, hemicellulase, hydrolase; 2.50A {Caulobacter vibrioides} Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>2yug_A Protein FRG1; spliceosome, facioscapulohumeral muscular dystrophy, FSHD1, beta-trefoil, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>2je8_A Beta-mannosidase; glycoside hydrolase, hydrolase; HET: B3P; 1.7A {Bacteroides thetaiotaomicron} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2vr4_A* 2vl4_A* 2vmf_A* 2vo5_A* 2vot_A* 2vqt_A* 2vjx_A* 2vqu_A* 2wbk_A* Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>3gm8_A Glycoside hydrolase family 2, candidate beta-GLYC; structural genomics, glycosidase, PSI-2, protein initiative; 2.40A {Bacteroides vulgatus} Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>3bga_A Beta-galactosidase; NYSGXRC, protein structure initiative II (PSI-II), glycosyl hydrolase family 2, jelly-roll fold; 2.10A {Bacteroides thetaiotaomicron vpi-5482} PDB: 3dec_A Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>2uwf_A Endoxylanase, alkaline active endoxylanase; hydrolase, xylan degradation, xylanase structure, glycosidase, alkaliphilic; 2.10A {Bacillus halodurans} PDB: 2f8q_A 2fgl_A* Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>1r85_A Endo-1,4-beta-xylanase; hydrolase; HET: GOL; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 1hiz_A* 1r87_A* 3mmd_A* 1r86_A Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>3emz_A Xylanase, endo-1,4-beta-xylanase; (alpha/beta)8 barrel, GH10 enzyme complex, hydrolase; HET: HXH; 2.08A {Bacillus SP} SCOP: c.1.8.3 PDB: 3emq_A* 3emc_A* Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>3kzs_A Glycosyl hydrolase family 5; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 2.10A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>2vzs_A CSXA, EXO-beta-D-glucosaminidase; hydrolase, GH2, glucosamine, glycoside hydrolase; HET: GCS; 1.85A {Amycolatopsis orientalis} SCOP: b.1.4.1 b.1.4.1 b.1.4.1 b.18.1.5 c.1.8.3 PDB: 2x05_A* 2x09_A* 2vzo_A 2vzt_A* 2vzv_A* 2vzu_A* Back     alignment and structure
>1qw9_A Arabinosidase, alpha-L-arabinofuranosidase; hydrolase; HET: KHP; 1.20A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 1pz2_A* 1qw8_A* 1pz3_A Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>2c7f_A Alpha-L-arabinofuranosidase; glycosidase, xylan, arabinan, hydrolase; HET: AHR; 2.7A {Clostridium thermocellum} SCOP: b.71.1.2 c.1.8.3 PDB: 2c8n_A Back     alignment and structure
>2y2w_A Arabinofuranosidase; hydrolase, arabinoxylan, glycoside hydrolase family 51; 2.50A {Bifidobacterium longum} Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure
>2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: XYP; 1.90A {Clostridium thermocellum} PDB: 2wze_A* 2wys_A* Back     alignment and structure
>3clw_A Conserved exported protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>3ug3_A Alpha-L-arabinofuranosidase; TIM barrel, hydrolase; 1.80A {Thermotoga maritima} PDB: 3ug4_A* 3ug5_A* 3s2c_A 4atw_A Back     alignment and structure
>3vny_A Beta-glucuronidase; TIM barrel, greek-KEY, glycoside hydrolase family 79, hydrol; 1.50A {Acidobacterium capsulatum} PDB: 3vnz_A* 3vo0_A* Back     alignment and structure
>2vrq_A Alpha-L-arabinofuranosidase; hydrolase, glycosidase; HET: XYP; 2.00A {Thermobacillus xylanilyticus} PDB: 2vrk_A Back     alignment and structure
>4h41_A Putative alpha-L-fucosidase; hydrolase, carbohydrate metabolism, HOST glycans, structural genomics; HET: MSE 1PE PE4 PG4 PG6; 1.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2y24_A Xylanase; hydrolase, GH5 family, aldotetraouronic acid; HET: XYP GCV PG4 PGE; 1.39A {Erwinia chrysanthemi} PDB: 1nof_A* Back     alignment and structure
>2nt0_A Glucosylceramidase; cerezyme, glucocerebrosidase, glucosylceramide, hydrolysis, disease, hydrolase; HET: NAG; 1.79A {Homo sapiens} SCOP: b.71.1.2 c.1.8.3 PDB: 1y7v_A* 2f61_A* 2j25_A* 2nsx_A* 1ogs_A* 2nt1_A* 3gxd_A* 3gxf_A* 3gxi_A* 3gxm_A* 3rik_A* 3ril_A* 2v3f_A* 2v3e_A* 2v3d_A* 2vt0_A* 2wcg_A* 2xwd_A* 2xwe_A* 2wkl_A* ... Back     alignment and structure
>2wnw_A Activated by transcription factor SSRB; hydrolase, salmonella typhimurium, O-glycosyl hydrolase family 30; 2.00A {Salmonella enterica subsp} Back     alignment and structure
>3gyc_A Putative glycoside hydrolase; YP_001304622.1, structural GEN joint center for structural genomics, JCSG; HET: MSE; 1.85A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3ro8_A Endo-1,4-beta-xylanase; glycosyl hydrolase family 10, GH10, (beta/alpha)8 fold, XYLA hydrolase; 1.34A {Paenibacillus SP} PDB: 3rdk_A 4e4p_A Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>3ur8_A Glucan endo-1,3-beta-D-glucosidase; glucoside hydrolase, GH17 family, pathogenesis-related class protein (PR-2), TIM barrel; 1.26A {Solanum tuberosum} PDB: 3ur7_A Back     alignment and structure
>1ghs_A 1,3-beta-glucanase; hydrolase; 2.30A {Hordeum vulgare} SCOP: c.1.8.3 Back     alignment and structure
>4aw7_A GH86A beta-porphyranase; hydrolase, porphyran-hexa-oligosaccharide, complex; HET: GLA GAL L6S AAL; 1.33A {Bacteroides plebeius} Back     alignment and structure
>2cyg_A Beta-1, 3-glucananse; endo-beta-1,3-glucanase, (beta-alpha)8-TIM-barrel, B-cell epitopes, allergen, banana, hydrolase; 1.45A {Musa acuminata} SCOP: c.1.8.3 Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3kl0_A Glucuronoxylanase XYNC; alpha beta barrel, (beta/alpha)8 barrel (beta/alpha)8 + beta motif family, hydrolase; HET: TAR HIS; 1.64A {Bacillus subtilis} PDB: 3gtn_A* 3kl3_A* 3kl5_A* Back     alignment and structure
>1aq0_A 1,3-1,4-beta-glucanase; hydrolase, glycosidase, glycoprotein, glycosylated protein; HET: NAG; 2.00A {Hordeum vulgare} SCOP: c.1.8.3 PDB: 1ghr_A Back     alignment and structure
>2yih_A CEL44C, xyloglucanase; hydrolase, GH44, endo-glucanase, carbohydrate-binding protei; HET: BGC; 1.70A {Paenibacillus polymyxa} PDB: 2yjq_A* 2ykk_A* 3zq9_A* Back     alignment and structure
>3zr5_A Galactocerebrosidase; hydrolase, GALC, glycosyl hydrolase, krabbe disease, TIM BAR lectin domain; HET: NAG; 2.10A {Mus musculus} PDB: 3zr6_A* Back     alignment and structure
>2vx5_A Cellvibrio japonicus mannanase cjman26C; hydrolase; HET: BMA; 1.47A {Cellvibrio japonicus} PDB: 2vx4_A* 2vx6_A* 2vx7_A* Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1jlx_A Agglutinin, amaranthin, ACA; complex (lectin/saccharide), T-disaccharide homodimer, bivalent, lectin; HET: GAL A2G; 2.20A {Amaranthus caudatus} SCOP: b.42.3.1 b.42.3.1 PDB: 1jly_A Back     alignment and structure
>3em5_A Beta-1,3-glucanase; glycoprotein, rossmann fold, (beta-alpha)8-TIM-barrel, glyco hydrolase, allergen; HET: NAG FUC MAN; 2.50A {Hevea brasiliensis} SCOP: c.1.8.3 PDB: 3f55_A* Back     alignment and structure
>1wdp_A Beta-amylase; (beta/alpha)8 barrel, hydrolase; 1.27A {Glycine max} SCOP: c.1.8.1 PDB: 1bfn_A* 1q6c_A 1wdr_A* 1v3i_A* 1v3h_A* 1q6d_A* 1q6g_A* 1wdq_A* 1wds_A* 1q6e_A* 1q6f_A* 2dqx_A 1byb_A* 1bya_A* 1byc_A* 1byd_A* 1uko_A 1ukp_A 1btc_A* Back     alignment and structure
>1fa2_A Beta-amylase; TIM barrel, hydrolase; HET: DOM; 2.30A {Ipomoea batatas} SCOP: c.1.8.1 Back     alignment and structure
>2xfr_A Beta-amylase; hydrolase, carbohydrate metabolism, glycosyl hydrolase famil starch degradation, germination; 0.97A {Hordeum vulgare} PDB: 2xff_A 2xfy_A* 2xg9_A* 2xgb_A* 2xgi_A* 1b1y_A* Back     alignment and structure
>3ik2_A Endoglucanase A; TIM-like barrel, hydrolase; 2.20A {Clostridium acetobutylicum} Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3tp4_A Computational design of enzyme; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; 1.98A {Synthetic construct} PDB: 2x2y_A 2bvy_A 2bvt_A Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>2e4t_A Endoglucanase, xyloglucanase; TIM barrel, TIM-like barrel, composite domain of glycosyl HY families 5, 30, 39 and 51, hydrolase; 0.96A {Clostridium thermocellum} PDB: 2e0p_A 2eo7_A* 2ej1_A* 2eex_A* 2eqd_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>2v3g_A Endoglucanase H; beta-1 4 beta-1 3 glucanase, lichenase, hydrolase, glycosidase, glycoside hydrolase family 26; HET: BGC NOY; 1.20A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 2bv9_A 2bvd_A* 2cip_A* 2cit_A* 2vi0_A* Back     alignment and structure
>3ii1_A Cellulase; CELM2, glucanase-xyanase, glucanase, xylanase, bifunctional enzyme, hydrolase; HET: BGC; 2.25A {Uncultured bacterium} PDB: 3fw6_A Back     alignment and structure
>1odz_A Mannanase A; hydrolase, family 26, glycoside-hydrolase, glycosynthase, manno-oligosaccharide; HET: MAN BMA; 1.4A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1r7o_A* 2whm_A* 1j9y_A 1gvy_A* 1gw1_A* Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>4a4a_A Alpha-N-acetylglucosaminidase family protein; hydrolase, 2 hydrolase, family 89 glycoside hydrolase, mucin carbohydrate-active enzyme; HET: NDG GAL; 1.90A {Clostridium perfringens} PDB: 2vcc_A 2vc9_A* 2vcb_A* 2vca_A Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>1jlx_A Agglutinin, amaranthin, ACA; complex (lectin/saccharide), T-disaccharide homodimer, bivalent, lectin; HET: GAL A2G; 2.20A {Amaranthus caudatus} SCOP: b.42.3.1 b.42.3.1 PDB: 1jly_A Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3pg0_A Threefoil; symmetric design, beta-trefoil, engineered module, sugar BIN NOVO protein; HET: BTB GOL; 1.62A {Artificial gene} Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1hcd_A Hisactophilin; actin binding; NMR {Dictyostelium discoideum} SCOP: b.42.5.2 PDB: 1hce_A Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>2ddx_A Beta-1,3-xylanase; glycoside hydrolase, TIM barrel, hydrola; 0.86A {Vibrio SP} Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>3ues_A Alpha-1,3/4-fucosidase; TIM barrel, hydrolase-hydrolase inhibitor complex; HET: DFU; 1.60A {Bifidobacterium longum subsp} PDB: 3mo4_A* 3uet_A* Back     alignment and structure
>3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>4acy_A Endo-alpha-mannosidase; hydrolase, endomannosidase, glycoside hydrolase, CAZY, enzyme-carbohydrate interaction, mannose; HET: MSE; 1.69A {Bacteroides thetaiotaomicron} PDB: 4acz_A 4ad0_A* 4acz_B Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>3eyp_A Putative alpha-L-fucosidase; structural genomics, hydrolase, lipoprotein, PSI-2, protein initiative; 1.90A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Back     alignment and structure
>3vsf_A Ricin B lectin; GH43 CBM13, EXO-beta-1,3-galactanase, sugar binding protein; 2.76A {Clostridium thermocellum} PDB: 3vsz_A* 3vt0_A* 3vt1_B* 3vt2_A* Back     alignment and structure
>1olt_A Oxygen-independent coproporphyrinogen III oxidase; heme biosynthesis, decarboxylase, radical SAM enzyme, 4Fe- 4 cluster; HET: SAM; 2.07A {Escherichia coli} SCOP: c.1.28.2 Back     alignment and structure
>4ad1_A Glycosyl hydrolase family 71; glycoside hydrolase GH99, CAZY, enzyme-carbohydra interaction, mannose glycosidase inhibition; 1.90A {Bacteroides xylanisolvens} PDB: 4ad2_A* 4ad3_A* 4ad4_A* 4ad5_A* Back     alignment and structure
>2k8e_A UPF0339 protein YEGP; protein structure initiative (PSI), northeast structur genomics consortium (NESG), ontario centre for structural P (OCSP); NMR {Escherichia coli} SCOP: d.348.1.1 d.348.1.1 Back     alignment and structure
>3q7x_A De novo designed beta-trefoil architecture with S primary structure; beta-terfoil, de novo protein; 1.40A {Synthetic} PDB: 3q7w_A 3o4d_A 3q7y_A 3o4b_A 3o4c_A 3o4a_A* 3o49_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 436
d1h4pa_408 c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yea 5e-65
d2pb1a1394 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast 4e-61
d1ceoa_340 c.1.8.3 (A:) Endoglucanase CelC {Clostridium therm 7e-33
d1h1na_305 c.1.8.3 (A:) Endocellulase EngI {Thermoascus auran 1e-24
d1edga_380 c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellu 6e-24
d1vjza_325 c.1.8.3 (A:) Endoglucanase homologue TM1752 {Therm 3e-23
d1ecea_358 c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellul 1e-21
d1ur4a_387 c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus lichen 4e-18
d1g01a_357 c.1.8.3 (A:) Alkaline cellulase K catalytic domain 7e-17
d7a3ha_300 c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradh 9e-14
d2c0ha1350 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue 2e-13
d1egza_291 c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysant 2e-12
d1dfca3123 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens 2e-12
d1wkya2297 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JA 9e-12
d1dfca1133 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens 4e-11
d1bqca_302 c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca 9e-11
d1qnra_344 c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [T 2e-10
d1rh9a1370 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycoper 4e-10
d1tvna1293 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalter 4e-10
d1kwga2393 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus t 7e-10
d1hcda_118 b.42.5.2 (A:) Histidine-rich actin-binding protein 3e-08
d1uuqa_410 c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [Ta 7e-08
d1foba_334 c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergi 3e-07
d1hjsa_332 c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heter 3e-06
d1dfca4111 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens 2e-05
d2vzsa5339 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolato 3e-04
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Exo-beta-(1,3)-glucanase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score =  212 bits (539), Expect = 5e-65
 Identities = 91/342 (26%), Positives = 148/342 (43%), Gaps = 43/342 (12%)

Query: 134 EYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPFV 193
           EY      G D A   LQ HW ++  ++DF  ++S G N VRIP+G+W            
Sbjct: 50  EYHFCQYLGKDLAKSRLQSHWSTFYQEQDFANIASQGFNLVRIPIGYWAFQILDDDPYVS 109

Query: 194 GGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWGDSNVADTVAVID 253
           G     LD A  WA    +KV VDLH A GSQNG ++S  RD ++   DSN+A T+ V++
Sbjct: 110 GLQESYLDQAIGWARNNSLKVWVDLHGAAGSQNGFDNSGLRDSYKFLEDSNLAVTINVLN 169

Query: 254 FLAARYAN---RPSLAAIELINEPLAPGVALDT-LKSYYKAGYDAVRKY-TSTAYVIMSN 308
           ++  +Y+       +  IELINEPL P + +D     Y    Y+ +R    S   +I+ +
Sbjct: 170 YILKKYSAEEYLDIVIGIELINEPLGPVLDMDKMKNDYLAPAYEYLRNNIKSDQVIIIHD 229

Query: 309 RLGPAD-HKELLSFASGLSRVVIDVHYYNLFSNNFNGLNVQQNIDYVNN----------- 356
              P +   + ++   G   V ID H+Y +F+++    ++ ++I                
Sbjct: 230 AFQPYNYWDDFMTENDGYWGVTIDHHHYQVFASDQLERSIDEHIKVACEWGTGVLNESHW 289

Query: 357 ----QRASDLGAVTTSNGPLTFVGEWTCEWNVKDAS--------------------KQDY 392
               + A+ L         + F   +   W   D +                    K++ 
Sbjct: 290 IVCGEFAAALTDCIKWLNSVGFGARYDGSWVNGDQTSSYIGSCANNDDIAYWSDERKENT 349

Query: 393 QRFANAQLDVYGRATFGWAYWAHKCE-ANHWSLKWMIENGYI 433
           +R+  AQLD +     GW  W +K E +  W  + ++ NG  
Sbjct: 350 RRYVEAQLDAF-EMRGGWIIWCYKTESSLEWDAQRLMFNGLF 390
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Length = 394 Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Length = 340 Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Length = 305 Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Length = 380 Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Length = 325 Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Length = 358 Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Length = 387 Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Length = 357 Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Length = 300 Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Length = 350 Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Length = 291 Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Length = 297 Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 133 Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Length = 302 Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Length = 344 Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Length = 370 Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Length = 293 Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Length = 393 Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Length = 118 Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Length = 410 Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Length = 334 Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Length = 332 Back     information, alignment and structure
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Length = 339 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query436
d2pb1a1394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 100.0
d1h4pa_408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 100.0
d1ceoa_340 Endoglucanase CelC {Clostridium thermocellum [TaxI 100.0
d1ecea_358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 100.0
d1h1na_305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 100.0
d1vjza_325 Endoglucanase homologue TM1752 {Thermotoga maritim 100.0
d1wkya2297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 100.0
d7a3ha_300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 100.0
d1g01a_357 Alkaline cellulase K catalytic domain {Bacillus sp 100.0
d1tvna1293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 100.0
d1edga_380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 100.0
d1egza_291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 100.0
d1bqca_302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 100.0
d1qnra_344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 99.93
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 99.93
d2c0ha1350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 99.91
d1ur4a_387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 99.88
d1uuqa_410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 99.87
d1dfca3123 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1foba_334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 99.77
d1hjsa_332 Beta-1,4-galactanase {Thielavia heterothallica, ak 99.75
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 99.71
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 99.57
d1hcda_118 Histidine-rich actin-binding protein (hisactophili 99.56
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 99.54
d1dfca4111 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.48
d1dfca1133 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1dfca3123 Fascin {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.37
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.31
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.3
d1qoxa_ 449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.26
d1pbga_ 468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.23
d1gnxa_ 464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.2
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.19
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 99.17
d1v02a_ 484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.13
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.11
d1tg7a5354 Beta-galactosidase LacA, N-terminal domain {Penici 99.1
d1vffa1 423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.05
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 98.98
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 98.94
d2vzsa5339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 98.9
d1jz8a5292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 98.89
d1wcga1 462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 98.89
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 98.8
d1cbga_ 490 Plant beta-glucosidase (myrosinase) {Creeping whit 98.75
d1yq2a5297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 98.73
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 98.73
d1e4mm_ 499 Plant beta-glucosidase (myrosinase) {White mustard 98.72
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 98.69
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 98.66
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 98.64
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 98.63
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 98.61
d1dfca4111 Fascin {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 98.34
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 98.27
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 98.25
d1nofa2277 Glycosyl hydrolase family 5 xylanase, catalytic do 98.23
d1r85a_371 Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 98.14
d1qw9a2367 Alpha-L-arabinofuranosidase, catalytic domain {Bac 97.92
d2nt0a2354 Glucosylceramidase, catalytic domain {Human (Homo 97.68
d1vema2 417 Bacterial beta-amylase {Bacillus cereus [TaxId: 13 97.22
d2v3ga1273 Endoglucanase H N-terminal domain {Clostridium the 96.83
d1ghsa_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 96.56
d2cyga1312 Plant beta-glucanases {Banana (Musa acuminata), 1, 96.55
d2bhua3420 Glycosyltrehalose trehalohydrolase, central domain 96.5
d1j0ha3382 Neopullulanase, central domain {Bacillus stearothe 96.42
d1ea9c3382 Maltogenic amylase, central domain {Bacillus sp., 96.25
d1aq0a_306 Plant beta-glucanases {Barley (Hordeum vulgare), 1 96.1
d1m7xa3396 1,4-alpha-glucan branching enzyme, central domain 96.06
d1ud2a2390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 96.05
d1upsa2131 GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosi 96.04
d1dfca2119 Fascin {Human (Homo sapiens) [TaxId: 9606]} 96.01
d1wzla3382 Maltogenic amylase, central domain {Thermoactinomy 95.96
d1gcya2357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 95.91
d1ht6a2347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 95.72
d1hvxa2393 Bacterial alpha-amylase {Bacillus stearothermophil 95.71
d1g94a2354 Bacterial alpha-amylase {Pseudoalteromonas halopla 95.57
d1h3ga3422 Cyclomaltodextrinase, central domain {Flavobacteri 95.51
d1eh9a3400 Glycosyltrehalose trehalohydrolase, central domain 95.42
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 95.36
d1mxga2361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 95.32
d1e43a2393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 95.28
d1lwha2391 4-alpha-glucanotransferase {Thermotoga maritima [T 95.24
d3bmva4406 Cyclodextrin glycosyltransferase {Thermoanaerobact 95.18
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 95.13
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 95.09
d2aaaa2381 Fungal alpha-amylases {Aspergillus niger, acid amy 95.0
d2d3na2394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 94.99
d1qhoa4407 Cyclodextrin glycosyltransferase {Bacillus stearot 94.98
d2guya2381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 94.94
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 94.55
d1hx0a2403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 94.55
d1ua7a2344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 94.08
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 93.34
d1wdpa1 490 beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} 92.98
d1jaea2378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 92.98
d1wzaa2409 Bacterial alpha-amylase {Halothermothrix orenii [T 92.69
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 92.57
d1fa2a_ 498 beta-Amylase {Sweet potato (Ipomoea batatas) [TaxI 92.46
d1b1ya_ 500 beta-Amylase {Barley (Hordeum vulgare) [TaxId: 451 92.12
d1dfca2119 Fascin {Human (Homo sapiens) [TaxId: 9606]} 91.18
d1qxma2138 Hemagglutinin component Ha1 {Clostridium botulinum 89.33
d1jaka1356 beta-N-acetylhexosaminidase {Streptomyces plicatus 88.54
d2bvya2366 Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708] 87.45
d2ihoa1154 Agglutinin MOA, N-terminal domain {Fairy-ring mush 86.99
d1ji1a3432 Maltogenic amylase, central domain {Thermoactinomy 86.79
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 86.54
d1odza_381 Mannanase A, ManA {Pseudomonas cellulosa (Cellvibr 83.7
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 80.68
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-glycanases
domain: Exo-beta-(1,3)-glucanase
species: Yeast (Candida albicans) [TaxId: 5476]

Probab=100.00  E-value=9.7e-55  Score=439.56  Aligned_cols=310  Identities=33%  Similarity=0.603  Sum_probs=253.2

Q ss_pred             CCCccccccccc-----ccccchhhhhccCcChhhHHHHHhhhhcCCHHHHHHHHhCCCCEEEecCccccccCCCCCCCC
Q 013777          118 SDPSVFKLNIVS-----TLRGEYQITNGFGPDKAPQVLQDHWDSYITDEDFKFLSSNGINAVRIPVGWWIANDPTPPKPF  192 (436)
Q Consensus       118 ~~ps~F~~~~~~-----~~~~e~~~~~~~G~~~a~~~~~~h~~~~ite~d~~~ia~~G~N~VRipv~~~~~~~~~~~~~~  192 (436)
                      ++|++|......     ...+|+++++.+|.+++.++|+.||++||||+||+.||++|||+|||||+||.+..+ +++++
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~e~~~~~~~g~~~~~~~~~~h~~~~it~~D~~~i~~~G~N~VRiPv~~~~~~~~-~~~~~  102 (394)
T d2pb1a1          24 MTPSLFEPFQNGNDQSGVPVDEYHWTQTLGKEAALRILQKHWSTWITEQDFKQISNLGLNFVRIPIGYWAFQLL-DNDPY  102 (394)
T ss_dssp             TCGGGTGGGCBTTBCTTSCCSHHHHHHHHCHHHHHHHHHHHHHHSSCHHHHHHHHHTTCCEEEEEEEGGGTCCC-TTCCC
T ss_pred             cCchhhhhccCCCccccccchHHHHHHHhChHHHHHHHHHHHhccCCHHHHHHHHHCCCCEEEEEecHHHhcCC-CCCcc
Confidence            467777654322     356799999999999999999999999999999999999999999999999977543 45678


Q ss_pred             ccchHHHHHHHHHHHHHcCCEEEEEcCCCCCCCCCCCCCCCCCCCCCCC-hhHHHHHHHHHHHHHHHhCCCC---ceeEE
Q 013777          193 VGGSSKVLDNAFDWAEKYGVKVIVDLHAAPGSQNGNEHSATRDGFQEWG-DSNVADTVAVIDFLAARYANRP---SLAAI  268 (436)
Q Consensus       193 ~~~~l~~ld~~v~~a~~~Gi~VilDlH~~pg~qng~~~sg~~~~~~~w~-~~~~~~~~~~~~~lA~ry~~~~---~v~g~  268 (436)
                      .++.+++||++|++|+++||+||||||.+||+|++.+++|... ...|. +.++++++++|+.||+||+++|   .|++|
T Consensus       103 ~~~~~~~ld~~i~~a~~~gl~VilDlH~~pg~~~~~~~~g~~~-~~~~~~~~~~~~~~~~~~~ia~~~~~~~~~~~v~g~  181 (394)
T d2pb1a1         103 VQGQVQYLEKALGWARKNNIRVWIDLHGAPGSQNGFDNSGLRD-SYNFQNGDNTQVTLNVLNTIFKKYGGNEYSDVVIGI  181 (394)
T ss_dssp             CCCHHHHHHHHHHHHHHTTCEEEEEEEECTTCSSCCGGGSSTT-CCCTTSTTHHHHHHHHHHHHHHHHSSGGGTTTEEEE
T ss_pred             chhHHHHHHHHHHHHHHCCcEEEEEeeccCCcccCcCCcCccC-ccccccHHHHHHHHHHHHHHHHHHccCCCCCceEEE
Confidence            8889999999999999999999999999999999999988653 34454 7899999999999999999976   69999


Q ss_pred             EeecCCCCCCCChhHHHHHHHHHHHHHHhhCCCeEEEEeCCCCCC-ChhhhhccCCCCCcEEEEEeecCcCCCCCCCCCh
Q 013777          269 ELINEPLAPGVALDTLKSYYKAGYDAVRKYTSTAYVIMSNRLGPA-DHKELLSFASGLSRVVIDVHYYNLFSNNFNGLNV  347 (436)
Q Consensus       269 eL~NEP~~~~~~~~~~~~~~~~~~~aIR~~~p~~~Viv~~~~~~~-~~~~~~~~~~~~~nvv~~~H~Y~~~~~~~~~~~~  347 (436)
                      ||+|||..+..+.+.+++||++++++||+++|+++|++++++.+. .+..++.......|+||++|+|.+|+......+.
T Consensus       182 el~NEP~~~~~~~~~~~~~~~~~~~~IR~~~~~~~I~i~~~~~~~~~~~~~~~~~~~~~~vv~d~H~Y~~f~~~~~~~~~  261 (394)
T d2pb1a1         182 ELLNEPLGPVLNMDKLKQFFLDGYNSLRQTGSVTPVIIHDAFQVFGYWNNFLTVAEGQWNVVVDHHHYQVFSGGELSRNI  261 (394)
T ss_dssp             ESCSCCCGGGSCHHHHHHHHHHHHHHHHHTTCCCCEEEECTTCCTTTTTTSSCGGGTCCSEEEEEECCSCSSHHHHTCCH
T ss_pred             eecccCCcccccHHHHHHHHHHHHHHHHHhCCCCeEEEcCCCcchhhhhhhccCCCCCceEEEeeecccccCCccccCCH
Confidence            999999875567789999999999999999999999999876543 3345555445678999999999998766666777


Q ss_pred             hhhHHHHHHhhhhhHHHhhhcCCCeEEeecccccCC---------------------------------CC---CcCHHH
Q 013777          348 QQNIDYVNNQRASDLGAVTTSNGPLTFVGEWTCEWN---------------------------------VK---DASKQD  391 (436)
Q Consensus       348 ~~~i~~i~~~~~~~~~~~~~~~~p~v~vGEwg~~~~---------------------------------~~---~~~~~~  391 (436)
                      .+++..++....    ... ....|+++|||+....                                 ..   ...++.
T Consensus       262 ~~~i~~~~~~~~----~~~-~~~~~~~~ge~s~~~~d~~~~~~~~~~~~~~~g~~~~~~~~Ge~~~~~d~~~~~~~~~~~  336 (394)
T d2pb1a1         262 NDHISVACNWGW----DAK-KESHWNVAGEWSAALTDCAKWLNGVNRGARYEGAYDNAPYIGSCQPLLDISQWSDEHKTD  336 (394)
T ss_dssp             HHHHHHHHHHHH----HHH-TCSSEEEEEECCSCSSCCSTTTTCTTCCCTTBTCSTTCCBCCCSGGGSSGGGCCHHHHHH
T ss_pred             HHHHHhhhhhhh----hhh-cccCcceeceecccchhhhhhhcccccccccccccCCCccccccccccChhhcCHHHHHH
Confidence            887777765321    111 2334577777764321                                 00   012456


Q ss_pred             HHHHHHHHHHHHccCCCcEEEEceecCC-CCCChHHHHhCCCccc
Q 013777          392 YQRFANAQLDVYGRATFGWAYWAHKCEA-NHWSLKWMIENGYIKL  435 (436)
Q Consensus       392 ~~~~~~~q~~~~~~~~~Gw~~W~~k~~~-~~Ws~~~~~~~g~~~~  435 (436)
                      +++|+++|+++|+ .+.||+||+||+++ +.|||+.++++|+||.
T Consensus       337 ~r~~~~aQ~~~~e-~~~GW~fWt~K~~~~~~W~~~~~~~~G~iP~  380 (394)
T d2pb1a1         337 TRRYIEAQLDAFE-YTGGWVFWSWKTENAPEWSFQTLTYNGLFPQ  380 (394)
T ss_dssp             HHHHHHHHHHHHH-TTTEEEESCSCCSSCGGGCHHHHHHTTCSCS
T ss_pred             HHHHHHHHHHHHh-cCCcEEEeccccCCCCCCCHHHHHHCCCcCC
Confidence            8899999999997 57899999999876 8999999999999984
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1hcda_ b.42.5.2 (A:) Histidine-rich actin-binding protein (hisactophilin) {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca1 b.42.5.1 (A:1008-1140) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dfca3 b.42.5.1 (A:1260-1382) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1dfca4 b.42.5.1 (A:1383-1493) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1nofa2 c.1.8.3 (A:44-320) Glycosyl hydrolase family 5 xylanase, catalytic domain {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1r85a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} Back     information, alignment and structure
>d1qw9a2 c.1.8.3 (A:18-384) Alpha-L-arabinofuranosidase, catalytic domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2nt0a2 c.1.8.3 (A:78-431) Glucosylceramidase, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vema2 c.1.8.1 (A:1-417) Bacterial beta-amylase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2v3ga1 c.1.8.3 (A:8-280) Endoglucanase H N-terminal domain {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ghsa_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d2cyga1 c.1.8.3 (A:29-340) Plant beta-glucanases {Banana (Musa acuminata), 1,3-beta-glucanase [TaxId: 4641]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1aq0a_ c.1.8.3 (A:) Plant beta-glucanases {Barley (Hordeum vulgare), 1,3-1,4-beta-glucanase [TaxId: 4513]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1upsa2 b.42.2.3 (A:290-420) GlcNAc-alpha-1,4-Gal-releasing endo-beta-galactosidase, GngC, C-terminal domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d1dfca2 b.42.5.1 (A:1141-1259) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1wdpa1 c.1.8.1 (A:6-495) beta-Amylase {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1fa2a_ c.1.8.1 (A:) beta-Amylase {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1b1ya_ c.1.8.1 (A:) beta-Amylase {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1dfca2 b.42.5.1 (A:1141-1259) Fascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxma2 b.42.2.1 (A:149-286) Hemagglutinin component Ha1 {Clostridium botulinum D phage [TaxId: 29342]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d2bvya2 c.1.8.3 (A:5-370) Mannanase A, ManA {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d2ihoa1 b.42.2.1 (A:2-155) Agglutinin MOA, N-terminal domain {Fairy-ring mushroom (Marasmius oreades) [TaxId: 181124]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1odza_ c.1.8.3 (A:) Mannanase A, ManA {Pseudomonas cellulosa (Cellvibrio japonicus) [TaxId: 155077]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure