Citrus Sinensis ID: 013782


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEGVSFPPSLPDFVEPGKVKVTTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNLLEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLVDCVRNPVFLDWEVNEELRKLKSELGELHNNPQGLLLEAIHSTGYAGALGNPLLAPESALNRLDGTILEEIVAENFTAPRMVLAASGVDLDELLPIAEPLLSDLPRLPPPTEPKSVYIGGDYRQQADSPETHIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQSFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKSAVLMNLESRKI
ccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEEcccccEEEEEcccccEEEEEEEECccccccccccccHHHHHHHHcccccccccHHHHHHHHHHcccEEEEEccccEEEEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccHHHcccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHcccccccccccccccccccccEEEcccccccEEEEEEcccccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHcccEEEEEEcccccccccEEEEEEEEccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccc
*****************NFQAMRY**************FFSWL***************************V*PGKVKVTTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNLLEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLVDCVRNPVFLDWEVNEELRKLKSELGELHNNPQGLLLEAIHSTGYAGALGNPLLAPESALNRLDGTILEEIVAENFTAPRMVLAASGVDLDELLPIAEPLL***************YIGGDYRQQADSPETHIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQSFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKSAVLMNLESRK*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRATVSRLGSLKGRLGNFQAMRYATSGAAAVRPSSPGFFSWLTGEQSSSLPSLDTPLEGVSFPPSLPDFVEPGKVKVTTLENGIRIASETSVSPAASIGLYLDFGSVYETPSSCGASNLLEKMAFKSTKNRSHLRIVREVEAIGGSILASASREQMGYSFDALKTYVPEMVELLVDCVRNPVFLDWEVNEELRKLKSELGELHNNPQGLLLEAIHSTGYAGALGNPLLAPESALNRLDGTILEEIVAENFTAPRMVLAASGVDLDELLPIAEPLLSDLPRLPPPTEPKSVYIGGDYRQQADSPETHIALAFEVPGGWLKDKEAIILTVLQVLMGGGGSFSAGGPGKGMHTRLYLRVLNEYQQIQSFSAFNSIFNNTGLFGIYACTGSDFVSKAVDLVVRELILIATPKQVTQVQLNRAKEATKSAVLMNLESRKI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial-processing peptidase subunit alpha This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. Mediate formation of the complex between cytochromes c and c1.probableP29677

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HR6, chain A
Confidence level:very confident
Coverage over the Query: 74-434
View the alignment between query and template
View the model in PyMOL