Citrus Sinensis ID: 013820

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------
MASVPSPKILQFAVQSRSMSANYLLFSSPSQPWPCSQKLRNASLFPIIVKVSSKVKCLTESTDEDRLSESEAVDDDVDGVREDTKVHVKRPQRTASSSSDSLSLGIREPVYEVVEVKSNGVVSTRKINRRQLLKSSGLRPRDIRSIDPSLFLTNSMPSLLVREHAILLNLGSLRAITMQERVFIFDYNRKGGQAFIDTLLPRLNPRNLNGSPCMPFMIEAVEAALLSRVQRLEQRLMHIEPRVQGLLEVLPNRLTADILEQLRISKQTLVELSSRAGALRQMLLDLLEDPHEIRRICIMGKNCTLRRGNDDVECSVPLEKQIAEEEEEEIEMLLENYLQRCESCHGQSERLLDSAKEMEDSIAVNLSSRRLEVSRVELLLQVGAFCVAVGALIAGIFGMNLKSYLEEHVFAFWLTTAGIIVGAVMAFLPHVLVSEG
ccccccccEEEccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccEEEEEEEHHHHHHHcccccccccccccccccccccccEEEEccEEEEEcccEEEEEEcccEEEEEccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcc
********************ANYLLFS****PWPCSQKLRNASLFPIIVKVSSKV*C************************************************IREPVYEVVEVKSNGVVSTRKINRRQLLKSSGLRPRDIRSIDPSLFLTNSMPSLLVREHAILLNLGSLRAITMQERVFIFDYNRKGGQAFIDTLLPRLNPRNLNGSPCMPFMIEAVEAALLSRVQRLEQRLMHIEPRVQGLLEVLPNRLTADILEQLRISKQTLVELSSRAGALRQMLLDLLEDPHEIRRICIMGKNC*******************AEEEEEEIEMLLENYLQRCESCHGQSERLLDSAKEMEDSIAVNLSSRRLEVSRVELLLQVGAFCVAVGALIAGIFGMNLKSYLEEHVFAFWLTTAGIIVGAVMAFLPHVLVSEG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASVPSPKILQFAVQSRSMSANYLLFSSPSQPWPCSQKLRNASLFPIIVKVSSKVKCLTESTDEDRLSESEAVDDDVDGVREDTKVHVKRPQRTASSSSDSLSLGIREPVYEVVEVKSNGVVSTRKINRRQLLKSSGLRPRDIRSIDPSLFLTNSMPSLLVREHAILLNLGSLRAITMQERVFIFDYNRKGGQAFIDTLLPRLNPRNLNGSPCMPFMIEAVEAALLSRVQRLEQRLMHIEPRVQGLLEVLPNRLTADILEQLRISKQTLVELSSRAGALRQMLLDLLEDPHEIRRICIMGKNCTLRRGNDDVECSVPLExxxxxxxxxxxxxxxxxxxxxCESCHGQSERLLDSAKEMEDSIAVNLSSRRLEVSRVELLLQVGAFCVAVGALIAGIFGMNLKSYLEEHVFAFWLTTAGIIVGAVMAFLPHVLVSEG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Magnesium transporter MRS2-A, chloroplastic Magnesium transporter that may mediate the influx of magnesium in chloroplast.probableQ9AUK4
Magnesium transporter MRS2-11, chloroplastic High-affinity magnesium transporter that mediates the influx of magnesium in chloroplast.probableQ058N4
Magnesium transporter MRS2-A, chloroplastic Magnesium transporter that may mediate the influx of magnesium in chloroplast.probableB8APK3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3RKG, chain A
Confidence level:very confident
Coverage over the Query: 110-303,323-370
View the alignment between query and template
View the model in PyMOL
Template: 2IUB, chain A
Confidence level:confident
Coverage over the Query: 109-294,327-398
View the alignment between query and template
View the model in PyMOL