Citrus Sinensis ID: 013846

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----
MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSFKT
ccccccccccccEEEEEccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccEEEEccccHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHccccccEEEEcHHHHHHHHccccccEEEEHHHccccHHHHHHHHHHcccEEEccHHHHHcccHHHHHHHHHcccEEEcccccHHHHHHHccccccccccEEEEEccccccccccHHHHHcccHHHHHccccccccccccccccccccHHHHHHHHHHccccccccEEEEEcccccccccEEcccccEEEcccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHccc
cccccccHHHccEEEEEcccccccccccccccEEEEEcccccEEEcEEEEEcccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHccccccEEEEEEEccccHHHHHHHHHHHcccEEEEccHHHHHHHHHHHHccccccccEEcHHHHHHHHccccccEEEEccccHHHHHHHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHccEEEEccHHHHHHHHcccccHHHcEEEEEEEEcccccccccHHHHccccHHHHccccccccccHHHHHHHHcHHHHHHHHHHHHHHcccHHHEEEEEcccccEEEEEEEccccEEEEEcccccHHHHHHHHHccccccccccccccccHHHcccEccEcccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcc
malnlqipAEIKALSFLETtrsnhrlpklsggfplkrkdnatatfgrivqcsaqgpppawpgravtetfrktwdgpkpisvlgstgsigtqTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANveekpeilagEQGVieaarhpdavTVVTGIVGCAGLKPTVAAIEAGKDIALANKEtliaggpfvlplahkhnikilpadsehSAIFQCIQGLPEGALRRIILTAsggafrdwpveklKEVKVADalkhpnwsmgkkitvDSATLFNKGLEVIEAHYLfgaeydnieiiihPQSIIHSMVetqdssvigqlgwpdmrlpiiytmswperiycseltwprldlsklgsltfvapdtakypsvnlayaagraggTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSFKT
MALNLQIPAEIKALSFlettrsnhrlpklsggfplkRKDNATATFGRIvqcsaqgpppawpgRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNItlladqvkrfkpQVVAVRNESLLDEIKEALanveekpeiLAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASggafrdwpvEKLKEVKVAdalkhpnwsmgkkITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENiallsfkt
MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNieiiihpqsiihsMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSFKT
************ALSF************************ATATFGRIVQCSAQG**PAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLS***
********AEIKALSFLET*R******KLSGGFPLKR*****************************************ISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSF**
MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSFKT
**LNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSFKT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVxxxxxxxxxxxxxxxxxxxxxPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALLSFKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query435 2.2.26 [Sep-21-2011]
Q9XFS9477 1-deoxy-D-xylulose 5-phos yes no 0.993 0.905 0.792 0.0
Q9XES0470 1-deoxy-D-xylulose 5-phos N/A no 0.977 0.904 0.793 0.0
Q8W250473 1-deoxy-D-xylulose 5-phos yes no 0.986 0.906 0.779 0.0
B0CD21401 1-deoxy-D-xylulose 5-phos yes no 0.779 0.845 0.687 1e-142
B2ITX3398 1-deoxy-D-xylulose 5-phos yes no 0.779 0.851 0.681 1e-140
B7K5G6398 1-deoxy-D-xylulose 5-phos yes no 0.788 0.861 0.684 1e-140
B8HVK1387 1-deoxy-D-xylulose 5-phos yes no 0.788 0.886 0.682 1e-140
Q8YP49399 1-deoxy-D-xylulose 5-phos yes no 0.779 0.849 0.675 1e-139
Q3MDL2398 1-deoxy-D-xylulose 5-phos yes no 0.779 0.851 0.678 1e-139
B1WNP5398 1-deoxy-D-xylulose 5-phos yes no 0.788 0.861 0.705 1e-136
>sp|Q9XFS9|DXR_ARATH 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Arabidopsis thaliana GN=DXR PE=2 SV=2 Back     alignment and function desciption
 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/439 (79%), Positives = 391/439 (89%), Gaps = 7/439 (1%)

Query: 1   MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQ-----G 55
           M LN   PAE KA+SFL+T+R N  +PKLSGGF L+R++     FG+ V+CS +      
Sbjct: 2   MTLNSLSPAESKAISFLDTSRFNP-IPKLSGGFSLRRRNQGRG-FGKGVKCSVKVQQQQQ 59

Query: 56  PPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNIT 115
           PPPAWPGRAV E  R++WDGPKPIS++GSTGSIGTQTLDIVAE+ DKFRVVALAAGSN+T
Sbjct: 60  PPPAWPGRAVPEAPRQSWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVT 119

Query: 116 LLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTG 175
           LLADQV+RFKP +VAVRNESL++E+KEALA+++ K EI+ GEQGVIE ARHP+AVTVVTG
Sbjct: 120 LLADQVRRFKPALVAVRNESLINELKEALADLDYKLEIIPGEQGVIEVARHPEAVTVVTG 179

Query: 176 IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCI 235
           IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLA+KHN+KILPADSEHSAIFQCI
Sbjct: 180 IVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLANKHNVKILPADSEHSAIFQCI 239

Query: 236 QGLPEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGL 295
           QGLPEGALR+IILTASGGAFRDWPVEKLKEVKVADALKHPNW+MGKKITVDSATLFNKGL
Sbjct: 240 QGLPEGALRKIILTASGGAFRDWPVEKLKEVKVADALKHPNWNMGKKITVDSATLFNKGL 299

Query: 296 EVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERI 355
           EVIEAHYLFGAEYD+IEI+IHPQSIIHSM+ETQDSSV+ QLGWPDMRLPI+YTMSWP+R+
Sbjct: 300 EVIEAHYLFGAEYDDIEIVIHPQSIIHSMIETQDSSVLAQLGWPDMRLPILYTMSWPDRV 359

Query: 356 YCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFI 415
            CSE+TWPRLDL KLGSLTF  PD  KYPS++LAYAAGRAGGTMTGVLSAANEKAVEMFI
Sbjct: 360 PCSEVTWPRLDLCKLGSLTFKKPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFI 419

Query: 416 DEKYVSLVLIENIALLSFK 434
           DEK   L + + + L   K
Sbjct: 420 DEKISYLDIFKVVELTCDK 438
Enzyme of the plastid non-mevalonate pathway for isoprenoid biosynthesis that catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4-phosphate (MEP). Required for chloroplast development.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 6EC: 7
>sp|Q9XES0|DXR_MENPI 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Mentha piperita GN=DXR PE=2 SV=2 Back     alignment and function description
>sp|Q8W250|DXR_ORYSJ 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic OS=Oryza sativa subsp. japonica GN=DXR PE=2 SV=2 Back     alignment and function description
>sp|B0CD21|DXR_ACAM1 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Acaryochloris marina (strain MBIC 11017) GN=dxr PE=3 SV=1 Back     alignment and function description
>sp|B2ITX3|DXR_NOSP7 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dxr PE=3 SV=1 Back     alignment and function description
>sp|B7K5G6|DXR_CYAP8 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Cyanothece sp. (strain PCC 8801) GN=dxr PE=3 SV=1 Back     alignment and function description
>sp|B8HVK1|DXR_CYAP4 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dxr PE=3 SV=1 Back     alignment and function description
>sp|Q8YP49|DXR_NOSS1 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dxr PE=3 SV=1 Back     alignment and function description
>sp|Q3MDL2|DXR_ANAVT 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dxr PE=3 SV=1 Back     alignment and function description
>sp|B1WNP5|DXR_CYAA5 1-deoxy-D-xylulose 5-phosphate reductoisomerase OS=Cyanothece sp. (strain ATCC 51142) GN=dxr PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
91241600471 1-deoxy-D-xylulose 5-phosphate reductois 0.993 0.917 0.836 0.0
225457034471 PREDICTED: 1-deoxy-D-xylulose 5-phosphat 0.993 0.917 0.834 0.0
255540669467 1-deoxy-D-xylulose 5-phosphate reductois 0.983 0.916 0.822 0.0
224119346471 predicted protein [Populus trichocarpa] 0.986 0.910 0.821 0.0
164604988471 1-deoxy-D-xylulose-5-phosphate reductois 0.993 0.917 0.829 0.0
224133538471 predicted protein [Populus trichocarpa] 0.986 0.910 0.821 0.0
46410854471 putative 1-deoxy-D-xylulose 5-phosphate 0.993 0.917 0.827 0.0
399514684473 1-deoxy-D-xylulose-5-phosphate reductois 0.995 0.915 0.818 0.0
133753347467 1-deoxy-D-xylulose 5-phosphate reductois 0.983 0.916 0.811 0.0
149944267474 1-deoxy-D-xylulose 5-phosphate reductois 0.995 0.913 0.807 0.0
>gi|91241600|gb|ABD92702.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] gi|94421688|gb|ABF18928.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] Back     alignment and taxonomy information
 Score =  742 bits (1915), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/434 (83%), Positives = 397/434 (91%), Gaps = 2/434 (0%)

Query: 1   MALNLQIPAEIKALSFLETTRSNHRLPKLSGGFPLKRKDNATATFGRIVQCSAQGPPPAW 60
           MALNL  PAEIKA+SFL++T+S+H L KL GGF LKRKD   A FG+ VQCSAQ PPPAW
Sbjct: 1   MALNLLSPAEIKAISFLDSTKSSH-LTKLPGGFSLKRKDFGAA-FGKKVQCSAQPPPPAW 58

Query: 61  PGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQ 120
           PGRA  +  RKTWDGPKPISV+GSTGSIGTQTLDIVAE+ DKFRVVALAAGSN+TLLADQ
Sbjct: 59  PGRAFPDLGRKTWDGPKPISVVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQ 118

Query: 121 VKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCA 180
           VK FKPQ+VAVRNESL+ E++EALA+VEEKPEI+ GEQGV+E ARHPDAV+VVTGIVGCA
Sbjct: 119 VKTFKPQLVAVRNESLVHELREALADVEEKPEIIPGEQGVVEVARHPDAVSVVTGIVGCA 178

Query: 181 GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPE 240
           GLKPTVAAIEAGKDI LANKETLIAGGPFVLPLAHK+N+KILPADSEHSAIFQCIQGLP+
Sbjct: 179 GLKPTVAAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQGLPD 238

Query: 241 GALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEA 300
           GALRRIILTASGGAFRDWPV+KLKEVKVADALKHPNW+MGKKITVDSATLFNKGLEVIEA
Sbjct: 239 GALRRIILTASGGAFRDWPVDKLKEVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEA 298

Query: 301 HYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSEL 360
           HYLFGAEYDNIEI+IHPQSIIHSMVETQDSSV+ QLGWPDMRLPI+YTMSWP+RIYCSE+
Sbjct: 299 HYLFGAEYDNIEIVIHPQSIIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRIYCSEI 358

Query: 361 TWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYV 420
           TWPRLDL KLGSLTF APD  KYPS++LAYAAGRAGGTMTGVLSAANEKAVEMFI+EK  
Sbjct: 359 TWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFINEKIG 418

Query: 421 SLVLIENIALLSFK 434
            L + + + L   K
Sbjct: 419 YLDIFKIVELTCDK 432

Source: Hevea brasiliensis

Species: Hevea brasiliensis

Genus: Hevea

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225457034|ref|XP_002282761.1| PREDICTED: 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplastic [Vitis vinifera] gi|297733784|emb|CBI15031.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255540669|ref|XP_002511399.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor, putative [Ricinus communis] gi|223550514|gb|EEF52001.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224119346|ref|XP_002318048.1| predicted protein [Populus trichocarpa] gi|222858721|gb|EEE96268.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|164604988|dbj|BAF98290.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|224133538|ref|XP_002321599.1| predicted protein [Populus trichocarpa] gi|222868595|gb|EEF05726.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|46410854|gb|AAS94121.1| putative 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Hevea brasiliensis] Back     alignment and taxonomy information
>gi|399514684|gb|AFP43697.1| 1-deoxy-D-xylulose-5-phosphate reductoisomerase [Eriobotrya japonica] Back     alignment and taxonomy information
>gi|133753347|gb|ABO38177.1| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Croton stellatopilosus] Back     alignment and taxonomy information
>gi|149944267|gb|AAY87151.2| 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Rauvolfia verticillata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query435
TIGR_CMR|BA_3959380 BA_3959 "1-deoxy-D-xylulose 5- 0.793 0.907 0.480 1.2e-83
TIGR_CMR|GSU_1915386 GSU_1915 "1-deoxy-D-xylulose 5 0.767 0.865 0.501 2e-81
TIGR_CMR|BA_3409385 BA_3409 "1-deoxy-D-xylulose 5- 0.765 0.864 0.460 1.1e-76
TIGR_CMR|SPO_1667395 SPO_1667 "1-deoxy-D-xylulose 5 0.765 0.843 0.433 3.8e-69
TIGR_CMR|CHY_1778384 CHY_1778 "1-deoxy-D-xylulose 5 0.765 0.867 0.457 2.1e-68
UNIPROTKB|P45568398 dxr "Dxr" [Escherichia coli K- 0.806 0.881 0.422 8.2e-67
TIGR_CMR|DET_0371377 DET_0371 "1-deoxy-D-xylulose 5 0.742 0.856 0.436 2e-63
UNIPROTKB|Q9KPV8402 dxr "1-deoxy-D-xylulose 5-phos 0.806 0.873 0.401 2.6e-63
TIGR_CMR|VC_2254402 VC_2254 "1-deoxy-D-xylulose 5- 0.806 0.873 0.401 2.6e-63
TIGR_CMR|CPS_1559411 CPS_1559 "1-deoxy-D-xylulose 5 0.774 0.819 0.419 1.8e-62
TIGR_CMR|BA_3959 BA_3959 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
 Score = 838 (300.0 bits), Expect = 1.2e-83, P = 1.2e-83
 Identities = 169/352 (48%), Positives = 236/352 (67%)

Query:    77 KPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESL 136
             K IS+LG++GSIGTQTLD++  H D+FR+VA + G NI      ++ F PQ+V+V+ E  
Sbjct:     2 KNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQIVSVQREE- 60

Query:   137 LDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIA 196
              D +K  L  V    +I+ G +G++E A HPDA  VV  +VG  GL PT+ AIEA K I 
Sbjct:    61 -DVLK--LQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEAKKTIG 117

Query:   197 LANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFR 256
             +ANKETL+  G  V+  A KHN+ +LP DSEHSAIFQC+ G  E  + R+I+TASGG+FR
Sbjct:   118 IANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITASGGSFR 177

Query:   257 DWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNXXXXXX 316
             D   ++L  V V DAL+HPNWSMG KIT+DSAT+ NKGLEVIEAH+LFG  Y+       
Sbjct:   178 DKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQIDVVLH 237

Query:   317 XXXXXXXMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFV 376
                    MVE +D SV+ QLG PDMR+PI Y +++P+R+  S+    +L+L ++G+L F 
Sbjct:   238 KESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTK--QLNLWEIGTLHFE 295

Query:   377 APDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENI 428
               +  ++  +  AY AG+AGG+M  V++AANE AVE F+ +K +  + +E++
Sbjct:   296 KMNQERFRCLRFAYEAGKAGGSMPAVMNAANEVAVEAFL-QKRIGFLTVEDL 346
GO:0008299 "isoprenoid biosynthetic process" evidence=ISS
GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=ISS
TIGR_CMR|GSU_1915 GSU_1915 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|BA_3409 BA_3409 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1667 SPO_1667 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_1778 CHY_1778 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
UNIPROTKB|P45568 dxr "Dxr" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|DET_0371 DET_0371 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Dehalococcoides ethenogenes 195 (taxid:243164)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KPV8 dxr "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2254 VC_2254 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_1559 CPS_1559 "1-deoxy-D-xylulose 5-phosphate reductoisomerase" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8DK30DXR_THEEB1, ., 1, ., 1, ., 2, 6, 70.68320.77700.8184yesno
Q46JT6DXR_PROMT1, ., 1, ., 1, ., 2, 6, 70.60110.78160.8252yesno
A5D2U3DXR_PELTS1, ., 1, ., 1, ., 2, 6, 70.53980.77010.8656yesno
Q7NID1DXR_GLOVI1, ., 1, ., 1, ., 2, 6, 70.63740.77930.8647yesno
B3E7B0DXR_GEOLS1, ., 1, ., 1, ., 2, 6, 70.53500.77470.8641yesno
A8MHH5DXR_ALKOO1, ., 1, ., 1, ., 2, 6, 70.52760.77010.8792yesno
Q319Z8DXR_PROM91, ., 1, ., 1, ., 2, 6, 70.62920.77930.8308yesno
Q7V6J8DXR_PROMM1, ., 1, ., 1, ., 2, 6, 70.60390.77010.8131yesno
Q3MDL2DXR_ANAVT1, ., 1, ., 1, ., 2, 6, 70.67830.77930.8517yesno
Q3AZ20DXR_SYNS91, ., 1, ., 1, ., 2, 6, 70.60270.80220.8369yesno
B7KAT5DXR_CYAP71, ., 1, ., 1, ., 2, 6, 70.69000.77930.8517yesno
Q31N26DXR_SYNE71, ., 1, ., 1, ., 2, 6, 70.65050.77930.8432yesno
B7K5G6DXR_CYAP81, ., 1, ., 1, ., 2, 6, 70.68490.78850.8618yesno
B0CD21DXR_ACAM11, ., 1, ., 1, ., 2, 6, 70.68710.77930.8453yesno
B3QXY0DXR_CHLT31, ., 1, ., 1, ., 2, 6, 70.52270.79770.8966yesno
Q0IBN9DXR_SYNS31, ., 1, ., 1, ., 2, 6, 70.62220.77930.8149yesno
A2C3T8DXR_PROM11, ., 1, ., 1, ., 2, 6, 70.60380.78160.8252yesno
A2BXK2DXR_PROM51, ., 1, ., 1, ., 2, 6, 70.60110.77930.8288yesno
Q8YP49DXR_NOSS11, ., 1, ., 1, ., 2, 6, 70.67540.77930.8496yesno
Q2JM39DXR_SYNJB1, ., 1, ., 1, ., 2, 6, 70.64320.77930.8647yesno
C0ZF60DXR_BREBN1, ., 1, ., 1, ., 2, 6, 70.53680.77010.8769yesno
Q7V0W0DXR_PROMP1, ., 1, ., 1, ., 2, 6, 70.60510.77010.8292yesno
Q9XFS9DXR_ARATH1, ., 1, ., 1, ., 2, 6, 70.79270.99310.9056yesno
Q9XES0DXR_MENPI1, ., 1, ., 1, ., 2, 6, 70.79350.97700.9042N/Ano
Q74BW4DXR_GEOSL1, ., 1, ., 1, ., 2, 6, 70.53090.76780.8652yesno
Q7U8C3DXR_SYNPX1, ., 1, ., 1, ., 2, 6, 70.61180.77010.8190yesno
B2ITX3DXR_NOSP71, ., 1, ., 1, ., 2, 6, 70.68120.77930.8517yesno
Q7VB62DXR_PROMA1, ., 1, ., 1, ., 2, 6, 70.60390.77010.8131yesno
Q185R8DXR_CLOD61, ., 1, ., 1, ., 2, 6, 70.51310.77470.8776yesno
Q3AI71DXR_SYNSC1, ., 1, ., 1, ., 2, 6, 70.61450.77930.8168yesno
Q9RCT1DXR_SYNP61, ., 1, ., 1, ., 2, 6, 70.65050.77930.8432yesno
B4S387DXR_PROA21, ., 1, ., 1, ., 2, 6, 70.53820.77010.8769yesno
B8HVK1DXR_CYAP41, ., 1, ., 1, ., 2, 6, 70.68200.78850.8863yesno
Q9KA69DXR_BACHD1, ., 1, ., 1, ., 2, 6, 70.52690.79310.9031yesno
A4J5Y5DXR_DESRM1, ., 1, ., 1, ., 2, 6, 70.53390.77240.8682yesno
B0THN7DXR_HELMI1, ., 1, ., 1, ., 2, 6, 70.53210.77700.8644yesno
Q8KG43DXR_CHLTE1, ., 1, ., 1, ., 2, 6, 70.54970.77470.8821yesno
Q819Y3DXR2_BACCR1, ., 1, ., 1, ., 2, 6, 70.50280.79310.9078yesno
Q2JXQ9DXR_SYNJA1, ., 1, ., 1, ., 2, 6, 70.65580.77470.8596yesno
Q8W250DXR_ORYSJ1, ., 1, ., 1, ., 2, 6, 70.77950.98620.9069yesno
B1WNP5DXR_CYAA51, ., 1, ., 1, ., 2, 6, 70.70520.78850.8618yesno
B0JWW6DXR_MICAN1, ., 1, ., 1, ., 2, 6, 70.69290.77930.8692yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.10.983
4th Layer1.1.1.2670.979

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
PLN02696454 PLN02696, PLN02696, 1-deoxy-D-xylulose-5-phosphate 0.0
PRK05447385 PRK05447, PRK05447, 1-deoxy-D-xylulose 5-phosphate 0.0
COG0743385 COG0743, Dxr, 1-deoxy-D-xylulose 5-phosphate reduc 0.0
TIGR00243389 TIGR00243, Dxr, 1-deoxy-D-xylulose 5-phosphate red 1e-169
PRK12464383 PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate 1e-164
pfam02670129 pfam02670, DXP_reductoisom, 1-deoxy-D-xylulose 5-p 5e-66
pfam0843684 pfam08436, DXP_redisom_C, 1-deoxy-D-xylulose 5-pho 1e-54
pfam13288118 pfam13288, DXPR_C, DXP reductoisomerase C-terminal 6e-36
COG0460333 COG0460, ThrA, Homoserine dehydrogenase [Amino aci 0.002
>gnl|CDD|215374 PLN02696, PLN02696, 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information 
 Score =  782 bits (2022), Expect = 0.0
 Identities = 328/399 (82%), Positives = 362/399 (90%), Gaps = 6/399 (1%)

Query: 25  RLPKLSGGFPLKRKDNATATFGRIVQCS-----AQGPPPAWPGRAVTETFRKTWDGPKPI 79
            LPKL GGF  KR   +  + GR  +CS        PPPAWPGRAV E  RK WDGPKPI
Sbjct: 2   PLPKLPGGFTTKRSS-SRQSRGRRAKCSVAGWSQNSPPPAWPGRAVVEPGRKGWDGPKPI 60

Query: 80  SVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDE 139
           S+LGSTGSIGTQTLDIVAE+ DKF+VVALAAGSN+TLLADQV++FKP++VAVRNESL+DE
Sbjct: 61  SLLGSTGSIGTQTLDIVAENPDKFKVVALAAGSNVTLLADQVRKFKPKLVAVRNESLVDE 120

Query: 140 IKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALAN 199
           +KEALA++++KPEI+ GE+G++E ARHP+AVTVVTGIVGCAGLKPTVAAIEAGKDIALAN
Sbjct: 121 LKEALADLDDKPEIIPGEEGIVEVARHPEAVTVVTGIVGCAGLKPTVAAIEAGKDIALAN 180

Query: 200 KETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWP 259
           KETLIAGGPFVLPLA KH +KILPADSEHSAIFQCIQGLPEG LRRIILTASGGAFRDWP
Sbjct: 181 KETLIAGGPFVLPLAKKHGVKILPADSEHSAIFQCIQGLPEGGLRRIILTASGGAFRDWP 240

Query: 260 VEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQS 319
           VEKLKEVKVADALKHPNWSMGKKITVDSATL NKGLEVIEAHYLFGA+YD+I+I+IHPQS
Sbjct: 241 VEKLKEVKVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQS 300

Query: 320 IIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPD 379
           IIHSMVETQDSSV+ QLGWPDMRLPI+YTMSWP+R+ CSE+TWPRLDL KLGSLTF APD
Sbjct: 301 IIHSMVETQDSSVLAQLGWPDMRLPILYTMSWPDRVPCSEITWPRLDLCKLGSLTFKAPD 360

Query: 380 TAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEK 418
             KYPS++LAYAAGRAGGTMTGVLSAANEKAVEMFIDEK
Sbjct: 361 NVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEK 399

Length = 454
>gnl|CDD|235472 PRK05447, PRK05447, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>gnl|CDD|223814 COG0743, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|161787 TIGR00243, Dxr, 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>gnl|CDD|237107 PRK12464, PRK12464, 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>gnl|CDD|217176 pfam02670, DXP_reductoisom, 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>gnl|CDD|203943 pfam08436, DXP_redisom_C, 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal Back     alignment and domain information
>gnl|CDD|222027 pfam13288, DXPR_C, DXP reductoisomerase C-terminal domain Back     alignment and domain information
>gnl|CDD|223536 COG0460, ThrA, Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 435
PLN02696454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 100.0
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 100.0
TIGR00243389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 100.0
PRK12464383 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 100.0
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 100.0
PF0843684 DXP_redisom_C: 1-deoxy-D-xylulose 5-phosphate redu 100.0
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 100.0
PF13288121 DXPR_C: DXP reductoisomerase C-terminal domain; PD 100.0
PRK06349426 homoserine dehydrogenase; Provisional 98.25
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 97.99
PRK13303265 L-aspartate dehydrogenase; Provisional 97.92
PRK11579346 putative oxidoreductase; Provisional 97.9
PRK06270341 homoserine dehydrogenase; Provisional 97.89
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.56
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 97.56
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.53
PRK08374336 homoserine dehydrogenase; Provisional 97.51
PRK06392326 homoserine dehydrogenase; Provisional 97.44
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.38
PRK06813346 homoserine dehydrogenase; Validated 97.35
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 97.32
COG0673342 MviM Predicted dehydrogenases and related proteins 97.27
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 97.09
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.0
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 96.94
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 96.9
PRK10206344 putative oxidoreductase; Provisional 96.84
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.8
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 96.79
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 96.72
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.65
PRK08300302 acetaldehyde dehydrogenase; Validated 96.63
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 96.58
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.56
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 96.49
PRK00048257 dihydrodipicolinate reductase; Provisional 96.32
PRK09436819 thrA bifunctional aspartokinase I/homoserine dehyd 96.22
TIGR00036266 dapB dihydrodipicolinate reductase. 96.18
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 95.88
PLN02700377 homoserine dehydrogenase family protein 95.62
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 95.34
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 95.28
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 95.18
PRK08040336 putative semialdehyde dehydrogenase; Provisional 95.15
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.0
PRK08219227 short chain dehydrogenase; Provisional 94.99
PLN02778298 3,5-epimerase/4-reductase 94.87
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 94.79
PRK10538248 malonic semialdehyde reductase; Provisional 94.73
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 94.73
PRK12829264 short chain dehydrogenase; Provisional 94.64
PRK08267260 short chain dehydrogenase; Provisional 94.64
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 94.62
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 94.58
PRK06947248 glucose-1-dehydrogenase; Provisional 94.51
TIGR03855229 NAD_NadX aspartate dehydrogenase. Members of this 94.51
PRK07806248 short chain dehydrogenase; Provisional 94.45
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 94.44
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 94.33
PRK07326237 short chain dehydrogenase; Provisional 94.27
PRK06101240 short chain dehydrogenase; Provisional 94.25
PRK07024257 short chain dehydrogenase; Provisional 94.23
PRK12828239 short chain dehydrogenase; Provisional 94.15
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.99
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 93.96
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.96
PRK12742237 oxidoreductase; Provisional 93.94
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.93
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 93.92
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 93.87
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 93.86
PRK09186256 flagellin modification protein A; Provisional 93.85
PRK07060245 short chain dehydrogenase; Provisional 93.84
PRK07825273 short chain dehydrogenase; Provisional 93.82
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.8
PRK06482276 short chain dehydrogenase; Provisional 93.74
PRK08263275 short chain dehydrogenase; Provisional 93.74
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 93.73
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 93.66
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 93.66
PRK07523255 gluconate 5-dehydrogenase; Provisional 93.63
PRK07454241 short chain dehydrogenase; Provisional 93.58
PRK05693274 short chain dehydrogenase; Provisional 93.56
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 93.55
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 93.47
PRK06057255 short chain dehydrogenase; Provisional 93.46
PLN02583297 cinnamoyl-CoA reductase 93.43
PRK05717255 oxidoreductase; Validated 93.41
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 93.38
PRK08265261 short chain dehydrogenase; Provisional 93.35
PRK06196315 oxidoreductase; Provisional 93.34
PRK07201 657 short chain dehydrogenase; Provisional 93.28
PRK08226263 short chain dehydrogenase; Provisional 93.27
PRK12939250 short chain dehydrogenase; Provisional 93.26
PLN03209 576 translocon at the inner envelope of chloroplast su 93.25
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 93.22
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 93.21
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.21
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 93.2
PRK08643256 acetoin reductase; Validated 93.19
PRK13301267 putative L-aspartate dehydrogenase; Provisional 93.16
PRK08628258 short chain dehydrogenase; Provisional 93.15
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 93.13
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 93.11
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 93.11
PRK12743256 oxidoreductase; Provisional 93.01
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 93.0
PRK06180277 short chain dehydrogenase; Provisional 93.0
PRK06181263 short chain dehydrogenase; Provisional 92.99
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 92.96
PRK07774250 short chain dehydrogenase; Provisional 92.94
PLN02260 668 probable rhamnose biosynthetic enzyme 92.93
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 92.9
PRK06182273 short chain dehydrogenase; Validated 92.83
PRK07035252 short chain dehydrogenase; Provisional 92.82
PRK06194287 hypothetical protein; Provisional 92.82
PRK07067257 sorbitol dehydrogenase; Provisional 92.75
PLN02383344 aspartate semialdehyde dehydrogenase 92.75
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 92.75
PRK08278273 short chain dehydrogenase; Provisional 92.74
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 92.68
PRK06138252 short chain dehydrogenase; Provisional 92.67
PRK08589272 short chain dehydrogenase; Validated 92.66
COG0300265 DltE Short-chain dehydrogenases of various substra 92.65
PRK11908347 NAD-dependent epimerase/dehydratase family protein 92.64
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 92.61
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 92.6
PRK09880343 L-idonate 5-dehydrogenase; Provisional 92.56
PLN02240352 UDP-glucose 4-epimerase 92.54
PRK12827249 short chain dehydrogenase; Provisional 92.47
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 92.47
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 92.46
PRK07102243 short chain dehydrogenase; Provisional 92.46
PRK07814263 short chain dehydrogenase; Provisional 92.44
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 92.4
COG2910211 Putative NADH-flavin reductase [General function p 92.4
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 92.36
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 92.35
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 92.32
PLN02260668 probable rhamnose biosynthetic enzyme 92.3
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 92.29
PLN02572442 UDP-sulfoquinovose synthase 92.28
PRK09135249 pteridine reductase; Provisional 92.28
PRK09072263 short chain dehydrogenase; Provisional 92.22
PRK06949258 short chain dehydrogenase; Provisional 92.22
PRK09134258 short chain dehydrogenase; Provisional 92.21
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 92.19
PLN02427386 UDP-apiose/xylose synthase 92.14
PRK12744257 short chain dehydrogenase; Provisional 92.12
PRK07890258 short chain dehydrogenase; Provisional 92.0
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 91.93
PRK06172253 short chain dehydrogenase; Provisional 91.91
PRK06500249 short chain dehydrogenase; Provisional 91.87
PRK12935247 acetoacetyl-CoA reductase; Provisional 91.85
PRK06924251 short chain dehydrogenase; Provisional 91.7
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 91.65
PRK05867253 short chain dehydrogenase; Provisional 91.63
PRK06701290 short chain dehydrogenase; Provisional 91.6
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 91.58
PRK06128300 oxidoreductase; Provisional 91.56
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 91.44
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 91.44
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 91.41
PRK09291257 short chain dehydrogenase; Provisional 91.39
PRK06483236 dihydromonapterin reductase; Provisional 91.39
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 91.29
PRK07904253 short chain dehydrogenase; Provisional 91.23
PRK06124256 gluconate 5-dehydrogenase; Provisional 91.21
PRK06914280 short chain dehydrogenase; Provisional 91.2
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 91.15
PRK07109334 short chain dehydrogenase; Provisional 91.15
PRK07063260 short chain dehydrogenase; Provisional 91.09
PRK07074257 short chain dehydrogenase; Provisional 91.08
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 91.06
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 91.03
PRK05993277 short chain dehydrogenase; Provisional 91.01
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 90.95
CHL00194317 ycf39 Ycf39; Provisional 90.94
PRK08017256 oxidoreductase; Provisional 90.94
PRK05872296 short chain dehydrogenase; Provisional 90.93
PRK07478254 short chain dehydrogenase; Provisional 90.93
PRK06841255 short chain dehydrogenase; Provisional 90.91
PLN02695370 GDP-D-mannose-3',5'-epimerase 90.89
PRK07832272 short chain dehydrogenase; Provisional 90.87
PRK12937245 short chain dehydrogenase; Provisional 90.86
PRK07831262 short chain dehydrogenase; Provisional 90.8
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 90.77
PRK09242257 tropinone reductase; Provisional 90.74
PRK06198260 short chain dehydrogenase; Provisional 90.73
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 90.64
PRK05875276 short chain dehydrogenase; Provisional 90.63
PRK07097265 gluconate 5-dehydrogenase; Provisional 90.62
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 90.59
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 90.56
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 90.48
PRK12938246 acetyacetyl-CoA reductase; Provisional 90.48
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 90.44
PRK10675338 UDP-galactose-4-epimerase; Provisional 90.38
PRK06197306 short chain dehydrogenase; Provisional 90.36
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 90.33
PLN00016378 RNA-binding protein; Provisional 90.3
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 90.28
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 90.22
TIGR01746367 Thioester-redct thioester reductase domain. It has 90.16
PRK08339263 short chain dehydrogenase; Provisional 90.1
PRK07453322 protochlorophyllide oxidoreductase; Validated 90.1
PRK12824245 acetoacetyl-CoA reductase; Provisional 90.07
TIGR02415254 23BDH acetoin reductases. One member of this famil 90.06
PLN00112444 malate dehydrogenase (NADP); Provisional 89.95
PRK05650270 short chain dehydrogenase; Provisional 89.93
PLN02653340 GDP-mannose 4,6-dehydratase 89.93
PLN02503 605 fatty acyl-CoA reductase 2 89.92
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 89.9
PRK08085254 gluconate 5-dehydrogenase; Provisional 89.89
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.84
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 89.82
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 89.8
PRK06139330 short chain dehydrogenase; Provisional 89.76
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 89.72
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 89.69
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 89.64
KOG1198347 consensus Zinc-binding oxidoreductase [Energy prod 89.63
PLN02253280 xanthoxin dehydrogenase 89.62
PRK07576264 short chain dehydrogenase; Provisional 89.57
PRK05854313 short chain dehydrogenase; Provisional 89.57
PRK08340259 glucose-1-dehydrogenase; Provisional 89.55
PF00551181 Formyl_trans_N: Formyl transferase; InterPro: IPR0 89.55
PRK12746254 short chain dehydrogenase; Provisional 89.51
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 89.48
PRK05866293 short chain dehydrogenase; Provisional 89.48
PRK06179270 short chain dehydrogenase; Provisional 89.42
PRK08177225 short chain dehydrogenase; Provisional 89.41
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 89.27
COG2201350 CheB Chemotaxis response regulator containing a Ch 89.26
PRK08213259 gluconate 5-dehydrogenase; Provisional 89.21
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.2
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 89.19
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 89.18
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 89.17
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 89.13
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 89.13
PRK08862227 short chain dehydrogenase; Provisional 88.97
PRK07775274 short chain dehydrogenase; Provisional 88.95
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 88.91
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 88.81
PLN02214342 cinnamoyl-CoA reductase 88.8
PRK08251248 short chain dehydrogenase; Provisional 88.79
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 88.78
PLN02996 491 fatty acyl-CoA reductase 88.72
PRK07023243 short chain dehydrogenase; Provisional 88.55
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 88.55
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 88.53
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 88.52
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 88.46
PRK06125259 short chain dehydrogenase; Provisional 88.44
PRK06114254 short chain dehydrogenase; Provisional 88.42
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 88.28
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 88.27
KOG4777361 consensus Aspartate-semialdehyde dehydrogenase [Am 88.23
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 88.22
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 88.18
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 88.18
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 88.17
PLN02896353 cinnamyl-alcohol dehydrogenase 88.08
PRK05876275 short chain dehydrogenase; Provisional 88.08
PRK06123248 short chain dehydrogenase; Provisional 88.04
PRK07062265 short chain dehydrogenase; Provisional 87.88
PRK07985294 oxidoreductase; Provisional 87.73
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 87.59
PRK14982340 acyl-ACP reductase; Provisional 87.57
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 87.46
PRK07677252 short chain dehydrogenase; Provisional 87.46
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.39
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 87.32
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 87.28
TIGR00639190 PurN phosphoribosylglycinamide formyltransferase, 87.24
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 87.19
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 87.16
PLN02206442 UDP-glucuronate decarboxylase 87.09
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 87.03
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 87.03
PRK06484 520 short chain dehydrogenase; Validated 87.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 86.95
PLN02166436 dTDP-glucose 4,6-dehydratase 86.9
PRK08277278 D-mannonate oxidoreductase; Provisional 86.69
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 86.51
PLN02650351 dihydroflavonol-4-reductase 86.5
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 86.46
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 86.46
PRK05855582 short chain dehydrogenase; Validated 86.33
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 86.33
PRK12747252 short chain dehydrogenase; Provisional 86.29
PRK08703239 short chain dehydrogenase; Provisional 86.28
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 86.05
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 86.04
PLN00198338 anthocyanidin reductase; Provisional 85.99
PRK05884223 short chain dehydrogenase; Provisional 85.94
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 85.9
PRK08936261 glucose-1-dehydrogenase; Provisional 85.86
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 85.62
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 85.62
KOG2741351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 85.57
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 85.56
PRK06953222 short chain dehydrogenase; Provisional 85.54
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 85.35
PRK06484520 short chain dehydrogenase; Validated 85.24
PLN02780320 ketoreductase/ oxidoreductase 85.16
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 85.15
PRK07069251 short chain dehydrogenase; Validated 85.01
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 84.95
PRK07577234 short chain dehydrogenase; Provisional 84.93
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 84.89
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 84.63
COG3320382 Putative dehydrogenase domain of multifunctional n 84.42
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 84.41
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 84.26
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 84.13
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 84.07
PRK07417279 arogenate dehydrogenase; Reviewed 83.97
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 83.93
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 83.84
PRK07791286 short chain dehydrogenase; Provisional 83.83
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 83.8
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 83.75
PRK08264238 short chain dehydrogenase; Validated 83.65
PRK07201657 short chain dehydrogenase; Provisional 83.52
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 83.45
PRK10124463 putative UDP-glucose lipid carrier transferase; Pr 83.29
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 83.05
PLN02514357 cinnamyl-alcohol dehydrogenase 82.97
PRK08303305 short chain dehydrogenase; Provisional 82.9
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 82.86
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 82.68
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 82.56
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 82.48
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 82.45
PRK08324681 short chain dehydrogenase; Validated 82.41
smart00822180 PKS_KR This enzymatic domain is part of bacterial 82.27
PRK06940275 short chain dehydrogenase; Provisional 82.23
PRK07856252 short chain dehydrogenase; Provisional 82.21
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 82.15
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 81.9
PLN02775286 Probable dihydrodipicolinate reductase 81.89
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 81.87
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 81.86
PLN02586360 probable cinnamyl alcohol dehydrogenase 81.79
PRK06027286 purU formyltetrahydrofolate deformylase; Reviewed 81.67
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 81.51
TIGR03025445 EPS_sugtrans exopolysaccharide biosynthesis polypr 81.24
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 81.11
COG3268382 Uncharacterized conserved protein [Function unknow 81.08
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 80.87
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 80.86
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 80.78
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 80.67
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 80.64
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 80.61
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 80.58
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 80.49
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 80.48
PLN02178375 cinnamyl-alcohol dehydrogenase 80.47
PRK06720169 hypothetical protein; Provisional 80.36
PLN02686367 cinnamoyl-CoA reductase 80.34
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 80.3
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information 
Probab=100.00  E-value=5.5e-161  Score=1235.12  Aligned_cols=405  Identities=82%  Similarity=1.284  Sum_probs=386.9

Q ss_pred             CCCCCCCcccccccccccccCceeeeec-----CCCCCCCCCccccccccCCCCCCeeEEEEecCChHhHHHHHHHHhCC
Q 013846           26 LPKLSGGFPLKRKDNATATFGRIVQCSA-----QGPPPAWPGRAVTETFRKTWDGPKPISVLGSTGSIGTQTLDIVAEHE  100 (435)
Q Consensus        26 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~k~I~IlGSTGSIG~qtLdVi~~~p  100 (435)
                      +++++|+...++++. ....++|++|+.     +.|+++||+++..++..+.|+++|||+|||||||||+||||||++||
T Consensus         3 ~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~KkI~ILGSTGSIGtqtLdVI~~~p   81 (454)
T PLN02696          3 LPKLPGGFTTKRSSS-RQSRGRRAKCSVAGWSQNSPPPAWPGRAVVEPGRKGWDGPKPISLLGSTGSIGTQTLDIVAENP   81 (454)
T ss_pred             cccCCCcceeccccc-cccccccccccccccccCCCCccCccccccCCcccccCCccEEEEecCCcHhhHHHHHHHHhCc
Confidence            358899999999998 777889999994     45789999999877778999999999999999999999999999999


Q ss_pred             CceEEEEEeccCCHHHHHHHHHhhCCCEEEEcCcchHHHHHHHHhcCCCCceEEechhHHHHHhcCCCCCEEEEeccccc
Q 013846          101 DKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCA  180 (435)
Q Consensus       101 d~f~VvaLaa~~N~~~L~~q~~~f~P~~v~v~~e~~~~~l~~~l~~~~~~~~v~~G~egl~~l~~~~~~D~Vv~AIvG~a  180 (435)
                      |+|+|++|++|+|+++|++|+++|+|++|++.|++.+.+|++.|.+.+.+++++.|++|++++++.+++|+||+||+|++
T Consensus        82 d~f~vvaLaag~Ni~lL~~q~~~f~p~~v~v~d~~~~~~l~~~l~~~~~~~~vl~G~egl~~la~~~evDiVV~AIvG~a  161 (454)
T PLN02696         82 DKFKVVALAAGSNVTLLADQVRKFKPKLVAVRNESLVDELKEALADLDDKPEIIPGEEGIVEVARHPEAVTVVTGIVGCA  161 (454)
T ss_pred             cccEEEEEECCCCHHHHHHHHHHhCCCEEEEcCHHHHHHHHHhhcCCCCCcEEEECHHHHHHHHcCCCCCEEEEeCcccc
Confidence            99999999999999999999999999999999999999999988532235789999999999999999999999999999


Q ss_pred             CcHHHHHHHHcCCceeecccceeeeccccchHHhhhcCCeEeecccchhhHHHhhcCCCCCccceEEEEeeCCCCCCCCh
Q 013846          181 GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAFRDWPV  260 (435)
Q Consensus       181 GL~pt~~Ai~~gK~iaLANKESLV~aG~lv~~~a~~~~~~IiPVDSEHsAIfQ~L~g~~~~~v~kIiLTASGGPFr~~~~  260 (435)
                      ||.||++||++||+|||||||||||||++|+++++++|++|+|||||||||||||+|+++++|+||||||||||||+||+
T Consensus       162 GL~pTl~AIkaGK~VALANKESLV~aG~lI~~~ak~~~~~IlPVDSEHsAIfQ~L~g~~~~~v~kiiLTASGGpFr~~~~  241 (454)
T PLN02696        162 GLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAKKHGVKILPADSEHSAIFQCIQGLPEGGLRRIILTASGGAFRDWPV  241 (454)
T ss_pred             chHHHHHHHHCCCcEEEecHHHHHhhHHHHHHHHHHcCCeEeecchhhHHHHHHccCCCccCccEEEEECCchhccCCCH
Confidence            99999999999999999999999999999999999999999999999999999999987778999999999999999999


Q ss_pred             hhhccCCHHHHhcCCCCCCCcccccchhhhhhhhHhHhHhhhhcCCCCCceEEEEcCCcceeEEEEecCCcEEEecCCCC
Q 013846          261 EKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPD  340 (435)
Q Consensus       261 e~L~~vT~~dALkHP~W~MG~KITIDSATmmNKgLEvIEA~~LF~i~~d~I~vvIHPqSiIHsmVef~DGSv~Aqls~PD  340 (435)
                      |+|++||++|||+||||+||+||||||||||||||||||||||||+|||+|||||||||||||||||+|||++||||+||
T Consensus       242 e~l~~vT~~~ALkHP~W~MG~KITIDSATmmNKglEvIEA~~LF~~~~d~I~vvIHPqSiIHsmVef~DGS~~Aql~~pD  321 (454)
T PLN02696        242 EKLKEVKVADALKHPNWSMGKKITVDSATLMNKGLEVIEAHYLFGADYDDIDIVIHPQSIIHSMVETQDSSVLAQLGWPD  321 (454)
T ss_pred             HHHhCCCHHHHhhCCCCcCCCeeeeehHhhhhhhHHHHHHHHHcCCCHHHeEEEECcCCeeeEEEEEcCCcEEEEecCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             chHHHHhcccCCCccccCCCCCCCCCCCCCCCceecCCCCCCCchHHHHHHHHHcCCCceeeeecchHHHHHHHHhCCCC
Q 013846          341 MRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYV  420 (435)
Q Consensus       341 MrlPI~yAL~yP~R~~~~~~~~~~ldl~~~~~LtF~~pD~~rFP~l~LA~~a~~~Gg~~p~vlNAANEvAV~aFL~~kI~  420 (435)
                      ||+||+|||+||+|.++++..+++|||.++++|||++||++|||||+|||+|+++||++|+|||||||+||++||+|||+
T Consensus       322 MrlPI~yAL~yP~R~~~~~~~~~~ldl~~~~~LtF~~pD~~rfP~l~La~~a~~~gg~~~~vlNAANEvAV~~FL~~kI~  401 (454)
T PLN02696        322 MRLPILYTMSWPDRVPCSEITWPRLDLCKLGSLTFKAPDNVKYPSMDLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKIG  401 (454)
T ss_pred             cHHHHHHHcCCccccccccCCCCCcCccccCCCeeeCCChhhCcHHHHHHHHHHhCCCceEEEEhhhHHHHHHHHcCCCC
Confidence            99999999999999964336789999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccHHHHHHhh
Q 013846          421 SLVLIENIALL  431 (435)
Q Consensus       421 F~dI~~ii~~~  431 (435)
                      |+||+++|+++
T Consensus       402 F~dI~~~i~~~  412 (454)
T PLN02696        402 YLDIFKVIELT  412 (454)
T ss_pred             chhHHHHHHHH
Confidence            99999999875

>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PF08436 DXP_redisom_C: 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal; InterPro: IPR013644 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PF13288 DXPR_C: DXP reductoisomerase C-terminal domain; PDB: 3A14_A 3A06_A 3IIE_A 2Y1D_B 4AIC_A 2JD0_B 2Y1C_B 2JD1_A 2JCX_A 2Y1G_A Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR03855 NAD_NadX aspartate dehydrogenase Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PLN00112 malate dehydrogenase (NADP); Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF00551 Formyl_trans_N: Formyl transferase; InterPro: IPR002376 A number of formyl transferases belong to this group Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>TIGR00639 PurN phosphoribosylglycinamide formyltransferase, formyltetrahydrofolate-dependent Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>PRK10124 putative UDP-glucose lipid carrier transferase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK06027 purU formyltetrahydrofolate deformylase; Reviewed Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>TIGR03025 EPS_sugtrans exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
1r0k_A388 Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate 5e-75
3au8_A488 Crystal Structure Of The Ternary Complex Of An Isom 4e-73
4gae_A426 Crystal Structure Of Plasmodium Dxr In Complex With 8e-73
1q0l_A406 Crystal Structure Of Dxr In Complex With Fosmidomyc 2e-71
3r0i_A410 Ispc In Complex With An N-Methyl-Substituted Hydrox 5e-71
1k5h_A398 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase Len 7e-71
3anl_A420 Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate 7e-71
1t1r_A398 Crystal Structure Of The Reductoisomerase Complexed 8e-71
2egh_A424 Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate 8e-71
3iie_A401 1-deoxy-d-xylulose 5-phosphate Reductoisomerase Fro 1e-68
1q0h_A406 Crystal Structure Of Selenomethionine-Labelled Dxr 8e-66
1jvs_A400 Crystal Structure Of 1-deoxy-d-xylulose 5-phosphate 3e-65
2jcv_A398 X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate R 2e-57
2c82_A413 X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate R 3e-57
2jcx_A398 X-Ray Structure Of Mutant 1-Deoxy-D-Xylulose 5-Phos 2e-56
3a06_A376 Crystal Structure Of Dxr From Thermooga Maritia, In 2e-46
>pdb|1R0K|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase From Zymomonas Mobilis Length = 388 Back     alignment and structure 
Iteration: 1

 Score =  278 bits (710), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 147/343 (42%), Positives = 213/343 (62%), Gaps = 6/343 (1%)
Query: 76  PKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNES 135
           P+ ++VLG+TGSIG  TLD++  + D+++V+AL A  N+  LAD  KR   +   + + S
Sbjct: 4   PRTVTVLGATGSIGHSTLDLIERNLDRYQVIALTANRNVKDLADAAKRTNAKRAVIADPS 63
Query: 136 LLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDI 195
           L +++KEALA      E  AG   ++EAA    A   +  I+GCAGLK T+AAI  GK +
Sbjct: 64  LYNDLKEALAG--SSVEAAAGADALVEAAMM-GADWTMAAIIGCAGLKATLAAIRKGKTV 120
Query: 196 ALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGLPEGALRRIILTASGGAF 255
           ALANKE+L++ G  ++    +H   +LP DSEH+AIFQC        +RRII+TASGG F
Sbjct: 121 ALANKESLVSAGGLMIDAVREHGTTLLPVDSEHNAIFQCFPHHNRDYVRRIIITASGGPF 180
Query: 256 RDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNXXXXX 315
           R   + ++  V    A++HPNWSMG KI++DSAT+ NKGLE+IEA +LF    +      
Sbjct: 181 RTTSLAEMATVTPERAVQHPNWSMGAKISIDSATMMNKGLELIEAFHLFQIPLEKFEILV 240
Query: 316 XXXXXXXXMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTF 375
                   MVE  D S++ Q+G PDMR PI +T++WP+R+   E     LD +KL  + F
Sbjct: 241 HPQSVIHSMVEYLDGSILAQIGSPDMRTPIGHTLAWPKRM---ETPAESLDFTKLRQMDF 297
Query: 376 VAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEK 418
            APD  ++P++ LA  + ++GG    V++AANE AV  F+D+K
Sbjct: 298 EAPDYERFPALTLAMESIKSGGARPAVMNAANEIAVAAFLDKK 340
>pdb|3AU8|A Chain A, Crystal Structure Of The Ternary Complex Of An Isomerase Length = 488 Back     alignment and structure
>pdb|4GAE|A Chain A, Crystal Structure Of Plasmodium Dxr In Complex With A Pyridine- Containing Inhibitor Length = 426 Back     alignment and structure
>pdb|1Q0L|A Chain A, Crystal Structure Of Dxr In Complex With Fosmidomycin Length = 406 Back     alignment and structure
>pdb|3R0I|A Chain A, Ispc In Complex With An N-Methyl-Substituted Hydroxamic Acid Length = 410 Back     alignment and structure
>pdb|1K5H|A Chain A, 1-Deoxy-D-Xylulose-5-Phosphate Reductoisomerase Length = 398 Back     alignment and structure
>pdb|3ANL|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase (Dxr) Complexed With Pyridin-2-Ylmethylphosphonic Acid Length = 420 Back     alignment and structure
>pdb|1T1R|A Chain A, Crystal Structure Of The Reductoisomerase Complexed With A Bisphosphonate Length = 398 Back     alignment and structure
>pdb|2EGH|A Chain A, Crystal Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase Complexed With A Magnesium Ion, Nadph And Fosmidomycin Length = 424 Back     alignment and structure
>pdb|3IIE|A Chain A, 1-deoxy-d-xylulose 5-phosphate Reductoisomerase From Yersinia Pestis. Length = 401 Back     alignment and structure
>pdb|1Q0H|A Chain A, Crystal Structure Of Selenomethionine-Labelled Dxr In Complex With Fosmidomycin Length = 406 Back     alignment and structure
>pdb|1JVS|A Chain A, Crystal Structure Of 1-deoxy-d-xylulose 5-phosphate Reductoisomerase; A Target Enzyme For Antimalarial Drugs Length = 400 Back     alignment and structure
>pdb|2JCV|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis, In Complex With Fosmidomycin And Nadph Length = 398 Back     alignment and structure
>pdb|2C82|A Chain A, X-Ray Structure Of 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis Length = 413 Back     alignment and structure
>pdb|2JCX|A Chain A, X-Ray Structure Of Mutant 1-Deoxy-D-Xylulose 5-Phosphate Reductoisomerase, Dxr, Rv2870c, From Mycobacterium Tuberculosis, In Complex With Fosmidomycin And Nadph Length = 398 Back     alignment and structure
>pdb|3A06|A Chain A, Crystal Structure Of Dxr From Thermooga Maritia, In Complex Fosmidomycin And Nadph Length = 376 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query435
1q0q_A406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 0.0
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 0.0
3au8_A488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 0.0
2y1e_A398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 0.0
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 0.0
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-10
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 2e-06
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 1e-05
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 1e-05
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 8e-04
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Length = 406 Back     alignment and structure
 Score =  625 bits (1614), Expect = 0.0
 Identities = 159/358 (44%), Positives = 214/358 (59%), Gaps = 13/358 (3%)

Query: 71  KTWDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVA 130
               G K +++LGSTGSIG  TLD+V  + + FRVVAL AG N+T + +Q   F P+   
Sbjct: 4   HHHSGMKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAV 63

Query: 131 VRNESLLDEIKEALANVEEKPEILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIE 190
           + +E+    +K  L     + E+L+G+Q   + A   D   V+  IVG AGL PT+AAI 
Sbjct: 64  MDDEASAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIR 123

Query: 191 AGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQG----------LPE 240
           AGK I LANKE+L+  G   +    +   ++LP DSEH+AIFQ +            L +
Sbjct: 124 AGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQ 183

Query: 241 GALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEA 300
             +  I+LT SGG FR+ P+  L  +    A +HPNWSMG+KI+VDSAT+ NKGLE IEA
Sbjct: 184 NGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEA 243

Query: 301 HYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSEL 360
            +LF A    +E++IHPQS+IHSMV  QD SV+ QLG PDMR PI +TM+WP R+     
Sbjct: 244 RWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSG-- 301

Query: 361 TWPRLDLSKLGSLTFVAPDTAKYPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEK 418
               LD  KL +LTF APD  +YP + LA  A   G   T  L+AANE  V  F+ ++
Sbjct: 302 -VKPLDFCKLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQ 358
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Length = 388 Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Length = 488 Back     alignment and structure
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Length = 398 Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Length = 376 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Length = 446 Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Length = 331 Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Length = 327 Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Length = 325 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
1q0q_A406 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 100.0
2y1e_A398 1-deoxy-D-xylulose 5-phosphate reductoisomerase; o 100.0
3au8_A488 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 100.0
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 100.0
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 100.0
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 98.83
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 98.67
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 98.67
3euw_A344 MYO-inositol dehydrogenase; protein structure init 98.56
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 98.55
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 98.55
3oqb_A383 Oxidoreductase; structural genomics, protein struc 98.49
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 98.48
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 98.44
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 98.44
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 98.42
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.39
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 98.38
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 98.36
3btv_A438 Galactose/lactose metabolism regulatory protein GA 98.36
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 98.34
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 98.3
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 98.25
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 98.22
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 98.21
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 98.2
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.16
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 98.16
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 98.16
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 98.15
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 98.12
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 98.12
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 98.11
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 98.07
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 98.07
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 98.07
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 98.05
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 97.99
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.98
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 97.93
1ydw_A362 AX110P-like protein; structural genomics, protein 97.91
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 97.89
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 97.83
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.82
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 97.79
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 97.76
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.75
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 97.73
4had_A350 Probable oxidoreductase protein; structural genomi 97.59
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 97.56
4h3v_A390 Oxidoreductase domain protein; structural genomics 97.47
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 97.47
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 97.47
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 97.46
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 97.45
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 97.42
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.38
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.17
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 97.04
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 97.0
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.86
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 96.84
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 96.75
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 96.74
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.69
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 96.54
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.51
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.5
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 96.37
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 96.29
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.23
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 96.12
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 96.05
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 96.02
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 96.01
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 95.98
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 95.89
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 95.88
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 95.87
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 95.84
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 95.64
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 95.57
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 95.47
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.45
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 95.43
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 95.38
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 95.35
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 95.32
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 95.3
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 95.29
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 95.24
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 95.22
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 95.21
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 95.16
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 95.16
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 95.14
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 95.12
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 95.11
2wm3_A299 NMRA-like family domain containing protein 1; unkn 95.06
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 95.03
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 95.03
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 94.95
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 94.95
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 94.95
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 94.94
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 94.91
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 94.9
1xq6_A253 Unknown protein; structural genomics, protein stru 94.87
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 94.86
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 94.85
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 94.83
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 94.77
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 94.76
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 94.72
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 94.72
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 94.68
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 94.68
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 94.65
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 94.65
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 94.63
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 94.6
3nkl_A141 UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fo 94.55
4eye_A342 Probable oxidoreductase; structural genomics, niai 94.54
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 94.54
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 94.45
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 94.45
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 94.38
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 94.37
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 94.37
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 94.36
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 94.32
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 94.3
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 94.29
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 94.29
3krt_A456 Crotonyl COA reductase; structural genomics, prote 94.27
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 94.25
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 94.24
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 94.23
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 94.22
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 94.15
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 94.14
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 94.11
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 94.1
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 94.09
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 94.06
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 94.03
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 93.98
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 93.96
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 93.95
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 93.95
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 93.94
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 93.91
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 93.88
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 93.88
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.85
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 93.84
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 93.84
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 93.84
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 93.83
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 93.83
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 93.81
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 93.81
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 93.79
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 93.78
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 93.74
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 93.72
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 93.72
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 93.71
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 93.71
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 93.69
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 93.69
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 93.68
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 93.67
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 93.66
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 93.65
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 93.65
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 93.63
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 93.6
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 93.6
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 93.57
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 93.57
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 93.54
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 93.54
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 93.53
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 93.52
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 93.51
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 93.51
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 93.49
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 93.48
4dqx_A277 Probable oxidoreductase protein; structural genomi 93.48
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 93.48
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 93.45
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 93.45
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 93.43
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 93.35
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 93.33
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 93.33
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 93.33
3fbg_A346 Putative arginate lyase; structural genomics, unkn 93.31
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 93.31
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 93.3
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 93.27
1nff_A260 Putative oxidoreductase RV2002; directed evolution 93.26
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 93.25
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 93.24
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 93.21
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 93.19
1xq1_A266 Putative tropinone reducatse; structural genomics, 93.18
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 93.16
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 93.14
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 93.12
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.12
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 93.07
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 93.06
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 93.04
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 93.03
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 93.03
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 93.02
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 93.02
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 92.99
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 92.99
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.98
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 92.93
4eso_A255 Putative oxidoreductase; NADP, structural genomics 92.92
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 92.91
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 92.9
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 92.86
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 92.86
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 92.84
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 92.83
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 92.82
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 92.82
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 92.79
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 92.78
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 92.76
2d59_A144 Hypothetical protein PH1109; COA binding, structur 92.73
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 92.73
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 92.72
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 92.7
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 92.69
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 92.67
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 92.66
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 92.64
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 92.64
3slg_A372 PBGP3 protein; structural genomics, seattle struct 92.63
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 92.6
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 92.59
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 92.55
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 92.55
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 92.54
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 92.49
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 92.45
1spx_A278 Short-chain reductase family member (5L265); paral 92.45
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 92.43
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 92.42
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 92.42
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 92.42
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 92.4
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 92.4
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 92.37
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 92.32
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 92.3
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 92.29
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 92.29
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 92.26
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 92.25
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 92.23
3tjr_A301 Short chain dehydrogenase; structural genomics, se 92.22
3e03_A274 Short chain dehydrogenase; structural genomics, PS 92.13
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 92.11
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 92.08
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 92.07
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 92.07
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 92.06
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 92.02
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 92.01
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 91.99
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 91.97
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 91.97
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 91.94
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 91.93
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 91.93
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 91.91
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 91.91
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 91.89
3tsc_A277 Putative oxidoreductase; structural genomics, seat 91.88
3gem_A260 Short chain dehydrogenase; structural genomics, AP 91.87
4f6l_B508 AUSA reductase domain protein; thioester reductase 91.85
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 91.84
3cxt_A291 Dehydrogenase with different specificities; rossma 91.82
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.8
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 91.8
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 91.79
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 91.76
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 91.73
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 91.73
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 91.7
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 91.68
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 91.67
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 91.67
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 91.66
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 91.65
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 91.62
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 91.6
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 91.59
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 91.59
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 91.56
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 91.54
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 91.5
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 91.5
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 91.5
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 91.47
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 91.46
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 91.45
4f6c_A427 AUSA reductase domain protein; thioester reductase 91.43
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 91.4
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 91.4
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 91.34
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 91.25
3auf_A229 Glycinamide ribonucleotide transformylase 1; struc 91.23
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 91.22
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 91.18
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 91.17
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 91.15
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 91.14
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 91.1
3da8_A215 Probable 5'-phosphoribosylglycinamide formyltransf 91.07
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 91.06
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 91.04
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 91.04
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 90.97
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 90.97
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 90.97
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 90.93
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 90.92
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 90.92
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 90.9
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 90.88
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 90.84
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 90.82
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 90.77
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 90.75
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 90.73
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 90.72
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 90.69
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 90.68
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 90.68
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.68
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 90.66
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 90.62
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 90.6
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 90.56
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 90.54
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 90.52
3edm_A259 Short chain dehydrogenase; structural genomics, ox 90.51
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 90.49
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 90.49
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 90.48
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 90.46
3ius_A286 Uncharacterized conserved protein; APC63810, silic 90.45
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 90.42
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 90.41
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 90.39
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 90.38
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 90.35
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 90.3
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 90.3
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 90.22
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 90.15
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 90.1
1xkq_A280 Short-chain reductase family member (5D234); parra 90.1
3tox_A280 Short chain dehydrogenase; structural genomics, PS 90.09
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 90.06
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 89.99
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 89.95
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 89.94
3rih_A293 Short chain dehydrogenase or reductase; structural 89.92
1xhl_A297 Short-chain dehydrogenase/reductase family member 89.9
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 89.86
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 89.82
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 89.8
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 89.79
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 89.75
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 89.75
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 89.69
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 89.65
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 89.59
4e7p_A150 Response regulator; DNA binding, cytosol, transcri 89.57
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 89.49
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 89.41
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 89.32
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 89.27
3qlj_A322 Short chain dehydrogenase; structural genomics, se 89.23
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 89.19
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 89.17
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 89.16
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 89.11
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 89.03
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 89.02
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 89.01
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 88.97
3imf_A257 Short chain dehydrogenase; structural genomics, in 88.91
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 88.91
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 88.57
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 88.46
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 88.39
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 88.38
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 88.34
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 88.29
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 88.27
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 88.14
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 88.03
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 87.99
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 87.94
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 87.85
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 87.8
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 87.73
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 87.69
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 87.67
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 87.54
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 87.5
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 87.48
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 87.44
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 87.35
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 87.33
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 87.32
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 87.31
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 87.31
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 87.25
3av3_A212 Phosphoribosylglycinamide formyltransferase; struc 87.24
2ywr_A216 Phosphoribosylglycinamide formyltransferase; rossm 87.21
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 87.12
2duw_A145 Putative COA-binding protein; ligand binding prote 86.97
2q5c_A196 NTRC family transcriptional regulator; structural 86.91
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 86.87
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 86.77
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 86.74
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 86.69
1jkx_A212 GART;, phosphoribosylglycinamide formyltransferase 86.66
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 86.54
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 86.51
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 86.51
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 86.36
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 86.31
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 86.18
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 86.15
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 86.07
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 86.06
3gms_A340 Putative NADPH:quinone reductase; structural genom 85.98
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 85.93
1iuk_A140 Hypothetical protein TT1466; structural genomics, 85.92
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 85.91
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 85.85
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 85.78
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 85.73
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 85.52
1lss_A140 TRK system potassium uptake protein TRKA homolog; 85.43
1jfl_A228 Aspartate racemase; alpha-beta structure, HOMO-dim 85.34
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 85.3
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 85.18
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 85.14
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 85.07
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 85.06
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 84.91
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 84.75
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 84.69
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 84.57
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 84.43
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 84.03
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 83.91
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 83.86
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 83.77
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 83.51
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 83.34
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 83.23
3p9x_A211 Phosphoribosylglycinamide formyltransferase; struc 83.19
3tqr_A215 Phosphoribosylglycinamide formyltransferase; purin 82.93
1meo_A209 Phosophoribosylglycinamide formyltransferase; puri 82.9
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 82.85
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 82.84
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 82.81
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 82.65
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 81.96
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 81.9
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 81.88
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 81.85
3kcq_A215 Phosphoribosylglycinamide formyltransferase; struc 81.74
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 81.71
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 81.59
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 81.56
4ds3_A209 Phosphoribosylglycinamide formyltransferase; struc 81.49
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 81.25
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 81.16
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 80.31
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 80.3
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 80.27
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 80.03
>1q0q_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase; HET: DXP NDP; 1.90A {Escherichia coli} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1q0l_A* 1q0h_A* 3r0i_A* 1k5h_A 1onn_A 1ono_A 1onp_A* 1jvs_A* 1t1r_A* 1t1s_A* 2egh_A* 3anm_A* 3anl_A* 3ann_A* 3iie_A Back     alignment and structure
Probab=100.00  E-value=3.6e-160  Score=1210.63  Aligned_cols=356  Identities=45%  Similarity=0.697  Sum_probs=342.8

Q ss_pred             CCCCeeEEEEecCChHhHHHHHHHHhCCCceEEEEEeccCCHHHHHHHHHhhCCCEEEEcCcchHHHHHHHHhcCCCCce
Q 013846           73 WDGPKPISVLGSTGSIGTQTLDIVAEHEDKFRVVALAAGSNITLLADQVKRFKPQVVAVRNESLLDEIKEALANVEEKPE  152 (435)
Q Consensus        73 ~~~~k~I~IlGSTGSIG~qtLdVi~~~pd~f~VvaLaa~~N~~~L~~q~~~f~P~~v~v~~e~~~~~l~~~l~~~~~~~~  152 (435)
                      ..+||+|+|||||||||+||||||++|||+|+|+||+||+|+++|++||++|+|++|++.|++.+.+|++.|...+.+++
T Consensus         6 ~~~~k~i~ILGSTGSIGtqtLdVi~~~pd~f~V~aL~ag~nv~~L~~q~~~f~p~~v~v~d~~~~~~L~~~l~~~~~~~~   85 (406)
T 1q0q_A            6 HSGMKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEASAKLLKTMLQQQGSRTE   85 (406)
T ss_dssp             ---CEEEEEETTTSHHHHHHHHHHHHCTTTEEEEEEEESSCHHHHHHHHHHHCCSEEEESSHHHHHHHHHHHHHTTCCCE
T ss_pred             cCCceeEEEEccCcHHHHHHHHHHHhCCCccEEEEEEcCCCHHHHHHHHHHhCCCEEEEcCHHHHHHHHHHhhcCCCCcE
Confidence            36899999999999999999999999999999999999999999999999999999999999999999998821135689


Q ss_pred             EEechhHHHHHhcCCCCCEEEEecccccCcHHHHHHHHcCCceeecccceeeeccccchHHhhhcCCeEeecccchhhHH
Q 013846          153 ILAGEQGVIEAARHPDAVTVVTGIVGCAGLKPTVAAIEAGKDIALANKETLIAGGPFVLPLAHKHNIKILPADSEHSAIF  232 (435)
Q Consensus       153 v~~G~egl~~l~~~~~~D~Vv~AIvG~aGL~pt~~Ai~~gK~iaLANKESLV~aG~lv~~~a~~~~~~IiPVDSEHsAIf  232 (435)
                      ++.|++|++++++.+++|+||+||||++||.||++||++||+|||||||||||||++||++++++|++|+||||||||||
T Consensus        86 v~~G~~~l~~~a~~~~~D~Vv~AIvG~aGL~PTlaAi~aGK~iaLANKEsLV~aG~lv~~~a~~~~~~ilPVDSEHsAIf  165 (406)
T 1q0q_A           86 VLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTILLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIF  165 (406)
T ss_dssp             EEESHHHHHHHHTCTTCCEEEECCSSGGGHHHHHHHHHTTCEEEECCHHHHHHHTHHHHHHHHHHTCEEEECSHHHHHHH
T ss_pred             EEeCHHHHHHHhcCCCCCEEEEccccHhHHHHHHHHHHCCCeEEEechHHHHhchHHHHHHHHHcCCeEEEecchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             Hhh----cCC------CCCccceEEEEeeCCCCCCCChhhhccCCHHHHhcCCCCCCCcccccchhhhhhhhHhHhHhhh
Q 013846          233 QCI----QGL------PEGALRRIILTASGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHY  302 (435)
Q Consensus       233 Q~L----~g~------~~~~v~kIiLTASGGPFr~~~~e~L~~vT~~dALkHP~W~MG~KITIDSATmmNKgLEvIEA~~  302 (435)
                      |||    +|.      +.++|+||||||||||||+||+|+|++|||+|||+||||+||+|||||||||||||||||||||
T Consensus       166 Q~L~~~~~g~~~~~~~~~~~V~kiiLTASGGPFR~~~~e~L~~vT~eqAl~HPnWsMG~KITIDSATmmNKGLEvIEA~~  245 (406)
T 1q0q_A          166 QSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARW  245 (406)
T ss_dssp             HTSCHHHHTTTTTSCTGGGTEEEEEEEECCCTTTTSCGGGGGGCCHHHHHCCSSCCCCHHHHHHHHHTHHHHHHHHHHHH
T ss_pred             HHcccccCCccccccCCcccccEEEEECCCcccCCCCHHHHhCCCHHHHhcCCCccCCCeeeehHHhHHhhhHHHHHHHH
Confidence            999    876      5456999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcCCCCCceEEEEcCCcceeEEEEecCCcEEEecCCCCchHHHHhcccCCCccccCCCCCCCCCCCCCCCceecCCCCCC
Q 013846          303 LFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWPDMRLPIIYTMSWPERIYCSELTWPRLDLSKLGSLTFVAPDTAK  382 (435)
Q Consensus       303 LF~i~~d~I~vvIHPqSiIHsmVef~DGSv~Aqls~PDMrlPI~yAL~yP~R~~~~~~~~~~ldl~~~~~LtF~~pD~~r  382 (435)
                      |||+|||||||||||||||||||||.|||++||||+||||+||+|||+||+|.   +..+++|||.++++|||++||++|
T Consensus       246 LF~~~~d~I~VvVHPQSiIHSmVef~DGSv~AQlg~PDMrlPIayAL~~P~R~---~~~~~~lDl~~~~~LtF~~pD~~r  322 (406)
T 1q0q_A          246 LFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRV---NSGVKPLDFCKLSALTFAAPDYDR  322 (406)
T ss_dssp             HHTCCGGGEEEEECTTCCEEEEEEETTSCEEEEECCSCTHHHHHHHHHTTSCC---CCSCCCCCTTTCCCBCCBCCCTTT
T ss_pred             HcCCCHHHeEEEECCCCceeEEEEEcCCcEEEEeCCCCcHHHHHHHcCCccCC---CCCCCCCCCCcCCCcEEeCCChhh
Confidence            99999999999999999999999999999999999999999999999999999   567899999999999999999999


Q ss_pred             CchHHHHHHHHHcCCCceeeeecchHHHHHHHHhCCCCcccHHHHHHhh
Q 013846          383 YPSVNLAYAAGRAGGTMTGVLSAANEKAVEMFIDEKYVSLVLIENIALL  431 (435)
Q Consensus       383 FP~l~LA~~a~~~Gg~~p~vlNAANEvAV~aFL~~kI~F~dI~~ii~~~  431 (435)
                      ||||+|||+|++.||++|+|||||||+||++||+|||+|+||+++|+++
T Consensus       323 FP~L~LA~~a~~~Gg~~p~vlNAANEvAV~aFL~~~I~F~dI~~ii~~~  371 (406)
T 1q0q_A          323 YPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALNLSV  371 (406)
T ss_dssp             CHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHTTSSCTTHHHHHHHHH
T ss_pred             CcHHHHHHHHHhcCCCceEeeEHHHHHHHHHHHcCCCCcchHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999986
>2y1e_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; oxidoreductase, DOXP/MEP pathway; 1.65A {Mycobacterium tuberculosis} PDB: 2jcv_A* 2jcz_A* 2jd2_A 2jd1_A 2y1d_A* 2y1c_A 2y1f_A* 2y1g_A* 3ras_A* 4a03_A* 4aic_A* 2jcx_A* 2jcy_A 2jd0_A* 2c82_A Back     alignment and structure
>3au8_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH binding; HET: NDP; 1.86A {Plasmodium falciparum} PDB: 3au9_A* 3aua_A* Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3nkl_A UDP-D-quinovosamine 4-dehydrogenase; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; HET: MSE GOL; 1.90A {Vibrio fischeri} Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3auf_A Glycinamide ribonucleotide transformylase 1; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; 2.07A {Symbiobacterium toebii} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3da8_A Probable 5'-phosphoribosylglycinamide formyltransferase PURN; glycinamide ribonucleotide transformylase, structure; 1.30A {Mycobacterium tuberculosis} PDB: 3dcj_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>4e7p_A Response regulator; DNA binding, cytosol, transcription regulator; 1.89A {Streptococcus pneumoniae} PDB: 4e7o_A Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3av3_A Phosphoribosylglycinamide formyltransferase; structural genomics, riken structural genomics/proteomics in RSGI, rossmann fold; HET: MSE; 1.70A {Geobacillus kaustophilus} Back     alignment and structure
>2ywr_A Phosphoribosylglycinamide formyltransferase; rossmann fold, structural genomics, NPPSFA; 1.77A {Aquifex aeolicus} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2q5c_A NTRC family transcriptional regulator; structural genomics, protein structure initiative; HET: SO4 GOL; 1.49A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1jkx_A GART;, phosphoribosylglycinamide formyltransferase; purine biosynthesis, anti-cancer agent; HET: 138; 1.60A {Escherichia coli} SCOP: c.65.1.1 PDB: 1cdd_A 1cde_A* 1c2t_A* 1grc_A 1gar_A* 2gar_A 3gar_A 1c3e_A* Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1jfl_A Aspartate racemase; alpha-beta structure, HOMO-dimer, homologous domains, isomer; 1.90A {Pyrococcus horikoshii} SCOP: c.78.2.1 c.78.2.1 PDB: 2dx7_A* 1iu9_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3p9x_A Phosphoribosylglycinamide formyltransferase; structural genomics, PSI-biology, protein STRU initiative; 1.90A {Bacillus halodurans} Back     alignment and structure
>3tqr_A Phosphoribosylglycinamide formyltransferase; purines, pyrimidines, nucleosides, nucleotides; HET: NHE; 1.97A {Coxiella burnetii} SCOP: c.65.1.0 Back     alignment and structure
>1meo_A Phosophoribosylglycinamide formyltransferase; purine biosynthesis; 1.72A {Homo sapiens} SCOP: c.65.1.1 PDB: 1njs_A* 1rbm_A* 1rbq_A* 1rby_A* 1rbz_A* 1rc0_A* 1rc1_A* 1zly_A* 1zlx_A* 1mej_B 1men_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3kcq_A Phosphoribosylglycinamide formyltransferase; structural genomics, niaid, seattle structural center for infectious disease, ssgcid; 2.20A {Anaplasma phagocytophilum} SCOP: c.65.1.0 Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>4ds3_A Phosphoribosylglycinamide formyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.85A {Brucella melitensis BV} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 435
d1q0qa3149 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphat 8e-52
d1r0ka3138 d.81.1.3 (A:127-264) 1-deoxy-D-xylulose-5-phosphat 1e-48
d1q0qa2151 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-p 2e-40
d1r0ka2150 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-p 1e-34
d1q0qa198 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphat 1e-13
d1r0ka195 a.69.3.1 (A:291-385) 1-deoxy-D-xylulose-5-phosphat 2e-12
d1t1ra326 c.2.1.3 (A:275-300) 1-deoxy-D-xylulose-5-phosphate 2e-04
>d1q0qa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Length = 149 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Dihydrodipicolinate reductase-like
domain: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
species: Escherichia coli [TaxId: 562]

 Score =  169 bits (428), Expect = 8e-52
 Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 10/149 (6%)

Query: 201 ETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQG----------LPEGALRRIILTA 250
           E+L+  G   +    +   ++LP DSEH+AIFQ +            L +  +  I+LT 
Sbjct: 1   ESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTG 60

Query: 251 SGGAFRDWPVEKLKEVKVADALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDN 310
           SGG FR+ P+  L  +    A +HPNWSMG+KI+VDSAT+ NKGLE IEA +LF A    
Sbjct: 61  SGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQ 120

Query: 311 IEIIIHPQSIIHSMVETQDSSVIGQLGWP 339
           +E++IHPQS+IHSMV  QD SV+ QLG P
Sbjct: 121 MEVLIHPQSVIHSMVRYQDGSVLAQLGEP 149
>d1r0ka3 d.81.1.3 (A:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Length = 138 Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Length = 151 Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Length = 150 Back     information, alignment and structure
>d1q0qa1 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 98 Back     information, alignment and structure
>d1r0ka1 a.69.3.1 (A:291-385) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Zymomonas mobilis [TaxId: 542]} Length = 95 Back     information, alignment and structure
>d1t1ra3 c.2.1.3 (A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Length = 26 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query435
d1q0qa3149 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 100.0
d1r0ka3138 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 100.0
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 100.0
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 100.0
d1q0qa198 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C 99.87
d1r0ka195 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C 99.86
d1t1ra326 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 98.69
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.96
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.64
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.48
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 97.48
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.44
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 97.37
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 97.23
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 97.23
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.16
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.16
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 97.1
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.08
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.01
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 96.83
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.83
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 96.74
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 96.68
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.58
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.44
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.41
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 96.4
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 96.3
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 96.29
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 96.22
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 96.12
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 96.09
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 96.05
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 96.04
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 95.96
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 95.79
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.75
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 95.75
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 95.71
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 95.66
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 95.64
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 95.58
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.58
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 95.48
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 95.46
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 95.46
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 95.44
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 95.42
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 95.37
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.93
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.91
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 94.86
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 94.76
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 94.61
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.42
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 94.36
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 94.36
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.22
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 94.16
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 94.15
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 93.87
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 93.71
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 93.7
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 93.64
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 93.54
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 93.13
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 93.1
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 93.07
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.01
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 92.92
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.92
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 92.91
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 92.85
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 92.66
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 92.55
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 92.54
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 92.45
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 92.21
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.2
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 92.15
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 92.12
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 92.11
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 92.09
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 92.08
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 91.99
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 91.88
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 91.64
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 91.33
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 91.11
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 91.0
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 90.91
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.69
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 90.59
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 89.94
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 89.91
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 89.88
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 89.76
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 89.47
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 89.46
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 89.41
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 89.24
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 89.21
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 89.13
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 88.95
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 88.84
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 88.15
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 87.9
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 87.81
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 87.73
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 87.68
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 87.38
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 87.3
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 87.25
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 87.08
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 86.78
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 86.76
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 86.58
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 86.41
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 85.76
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 85.48
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 85.17
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 85.13
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 85.11
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 84.89
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 84.79
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 84.67
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 84.55
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 84.48
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 84.09
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 83.81
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 83.76
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 83.61
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 83.42
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 83.31
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 83.26
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 82.88
d2csua3163 Acetate-CoA ligase alpha chain, AcdA, domains 2 an 82.73
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 82.69
d3bula2156 Methionine synthase, C-terminal domain {Escherichi 82.49
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 82.45
d1xrsb1160 D-lysine 5,6-aminomutase beta subunit KamE, C-term 82.3
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 82.27
d1ccwa_137 Glutamate mutase, small subunit {Clostridium cochl 82.17
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 82.04
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 81.98
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 81.72
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 81.53
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 80.82
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 80.81
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 80.76
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 80.64
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 80.5
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 80.44
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 80.38
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.25
>d1q0qa3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: Dihydrodipicolinate reductase-like
domain: 1-deoxy-D-xylulose-5-phosphate reductoisomerase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=5.7e-79  Score=545.91  Aligned_cols=139  Identities=49%  Similarity=0.823  Sum_probs=135.0

Q ss_pred             ceeeeccccchHHhhhcCCeEeecccchhhHHHhhcCC----------CCCccceEEEEeeCCCCCCCChhhhccCCHHH
Q 013846          201 ETLIAGGPFVLPLAHKHNIKILPADSEHSAIFQCIQGL----------PEGALRRIILTASGGAFRDWPVEKLKEVKVAD  270 (435)
Q Consensus       201 ESLV~aG~lv~~~a~~~~~~IiPVDSEHsAIfQ~L~g~----------~~~~v~kIiLTASGGPFr~~~~e~L~~vT~~d  270 (435)
                      |||||||+++++.++++|++|+|||||||||||||++.          +.+.|++|+|||||||||++++++|++||++|
T Consensus         1 EslV~aG~li~~~akk~~~~iiPvDSEH~AIfQ~l~~~~~~~~~~~~~~~~~I~ki~LTASGGPF~~~~~~~l~~vt~~~   80 (149)
T d1q0qa3           1 ESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVSILLTGSGGPFRETPLRDLATMTPDQ   80 (149)
T ss_dssp             HHHHHHTHHHHHHHHHHTCEEEECSHHHHHHHHTSCHHHHTTTTTSCTGGGTEEEEEEEECCCTTTTSCGGGGGGCCHHH
T ss_pred             CcEEEcHHHHHHHHHHcCCeEEecChHHHHHHHHhhhhhhcccccccccccceeEEEEEcCCccccccchhhhhccCHHH
Confidence            89999999999999999999999999999999999742          34679999999999999999999999999999


Q ss_pred             HhcCCCCCCCcccccchhhhhhhhHhHhHhhhhcCCCCCceEEEEcCCcceeEEEEecCCcEEEecCCC
Q 013846          271 ALKHPNWSMGKKITVDSATLFNKGLEVIEAHYLFGAEYDNIEIIIHPQSIIHSMVETQDSSVIGQLGWP  339 (435)
Q Consensus       271 ALkHP~W~MG~KITIDSATmmNKgLEvIEA~~LF~i~~d~I~vvIHPqSiIHsmVef~DGSv~Aqls~P  339 (435)
                      ||+||||+||+|||||||||||||||+||||||||+++++|+|||||||||||||+|.|||++||||.|
T Consensus        81 Al~HP~W~MG~KIsIDSATmmNKglEvIEA~~LF~l~~~kI~v~IHpqSiiHs~V~f~DGs~~a~~~~P  149 (149)
T d1q0qa3          81 ACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEP  149 (149)
T ss_dssp             HHCCSSCCCCHHHHHHHHHTHHHHHHHHHHHHHHTCCGGGEEEEECTTCCEEEEEEETTSCEEEEECCS
T ss_pred             HhhCCcccccceeeccHHHHHHHHHHHHHHHHHhCCCHHHEEEEECCCCeeeEEEEECCCCEEEeccCC
Confidence            999999999999999999999999999999999999999999999999999999999999999999998
>d1r0ka3 d.81.1.3 (A:127-264) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q0qa1 a.69.3.1 (A:301-398) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ka1 a.69.3.1 (A:291-385) 1-deoxy-D-xylulose-5-phosphate reductoisomerase, C-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1t1ra3 c.2.1.3 (A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2csua3 c.23.4.1 (A:291-453) Acetate-CoA ligase alpha chain, AcdA, domains 2 and 3 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d3bula2 c.23.6.1 (A:741-896) Methionine synthase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xrsb1 c.23.6.1 (B:102-261) D-lysine 5,6-aminomutase beta subunit KamE, C-terminal domain {Clostridium sticklandii [TaxId: 1511]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ccwa_ c.23.6.1 (A:) Glutamate mutase, small subunit {Clostridium cochlearium [TaxId: 1494]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure