Citrus Sinensis ID: 013867


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-----
MRTVFKLSRLATTVSGINRLPGPTSHEPCLLSASTLPPPRRLVHDANGNGNRINGLNSNPVVLQMINYALSHARSQKSDESYSQGMLVLEQCLSTQPSDGQLAESWRGISLLAMSTLLYESGNYVEAIEKLQKVENFKNSILGVRVAAMEALAGLYLQLGQDDTSSVVADKCLQLCEKHKPENYKTYGAVNSRANAVKGLVELAHGNLESGLQEEEGCTGSAALSYGEYLHATRNFLLAKKFYQKVIEVLAEQKDFSDMNTLGSCNMALEEVALAATFALGQLEAHMGNFGDAEEILTRTLTKTEELFGSHHPKVGVVLTCLALMFRNKAMQEHSSALLIQEGLYRRALEFLKAPPLESEGVETKVDRTDIVALARGGYAEALSVQQNRKDEGERMKRWAEAAWRNRRVSLAEALNFSEPSNKPLVIDARTSRTM
cHHHHHHHHHHHHHHccccccccccccHHHcccccccccHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccccccHHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccccHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHHHccccccHHHHccccccccccccHHHHHcccc
*******SRLATTVSGINRLPGPTSHEP***********RRLVHDANGN***INGLNSNPVVLQMINYALSHARSQKSDESYSQGMLVLEQCLST*****QLAESWRGISLLAMSTLLYESGNYVEAIEKLQKVENFKNSILGVRVAAMEALAGLYLQLGQDDTSSVVADKCLQLCEKHKPENYKTYGAVNSRANAVKGLVELAHGNLESGLQEEEGCTGSAALSYGEYLHATRNFLLAKKFYQKVIEVLAEQKDFSDMNTLGSCNMALEEVALAATFALGQLEAHMGNFGDAEEILTRTLTKTEELFGSHHPKVGVVLTCLALMFRNKAMQEHSSALLIQEGLYRRALEFLKAPPLESEGVETKVDRTDIVALARGGYAEALSVQQNRKDEGERMKRWAEAAWRNRRVSLAEALNFSEPSNKPLVIDARTSRTM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTVFKLSRLATTVSGINRLPGPTSHEPCLLSASTLPPPRRLVHDANGNGNRINGLNSNPVVLQMINYALSHARSQKSDESYSQGMLVLEQCLSTQPSDGQLAESWRGISLLAMSTLLYESGNYVEAIEKLQKVENFKNSILGVRVAAMEALAGLYLQLGQDDTSSVVADKCLQLCEKHKPENYKTYGAVNSRANAVKGLVELAHGNLESGLQEEEGCTGSAALSYGEYLHATRNFLLAKKFYQKVIEVLAEQKDFSDMNTLGSCNMALEEVALAATFALGQLEAHMGNFGDAEEILTRTLTKTEELFGSHHPKVGVVLTCLALMFRNKAMQEHSSALLIQEGLYRRALEFLKAPPLESEGVETKVDRTDIVALARGGYAEALSVQQNRKDEGERMKRWAEAAWRNRRVSLAEALNFSEPSNKPLVIDARTSRTM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ULQ, chain A
Confidence level:very confident
Coverage over the Query: 68-179,206-332,343-388
View the alignment between query and template
View the model in PyMOL
Template: 3ULQ, chain A
Confidence level:very confident
Coverage over the Query: 56-178,204-255,269-355
View the alignment between query and template
View the model in PyMOL
Template: 3HYM, chain B
Confidence level:confident
Coverage over the Query: 65-261,273-403
View the alignment between query and template
View the model in PyMOL
Template: 2Y4T, chain A
Confidence level:confident
Coverage over the Query: 59-255,273-414
View the alignment between query and template
View the model in PyMOL