Citrus Sinensis ID: 013883


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----
MQCQCTWTCCESKMLKPSAFGSSFSSSALLSFSKHLHTISITDSANTRRRGISTTCPRYPSLMASLSTVSTNQSDTIQKTNLQPQQVAKRLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPDFVKDAAIQAIRDGKNQYARGHGVPEFNSAIASRFKKDSGLEVDPEKEVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAGAKIKCITLRPPDFAIPIEELKSTISKNTRAILMNTPHNPTGKMFTREELNVIASLCIENDVLVFSDEVYDKLAFEMDHISIASLPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAATAALRAPETYYEELKRDYSAKKAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHETDIAFCEYLIKEVGVVAIPTSVFY
ccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEccHHHHHHHHHHHccccccEEEEEccccccHHHHHHHcccEEEEECcccccccccHHHHHHHccccccEEEEccccccccccccHHHHHHHHHHHHHccCEEEEcccccccccccccccccccccccccEEEEccccccccccccccHHccccHHHHHHHHHHccccCCccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHcccccCCcccccEEEECcccccccccHHHHHHHHHHHccEEEEcccccc
****CTWTCCESKMLKPSAFGSSFSSSALLSFSKHLHTISIT***********************************************RLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPDFVKDAAIQAIRDGKNQYARGHGVPEFNSAIASRFKKDSGLEVDPEKEVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAGAKIKCITLRPPDFAIPIEELKSTISKNTRAILMNTPHNPTGKMFTREELNVIASLCIENDVLVFSDEVYDKLAFEMDHISIASLPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAATAALRAPETYYEELKRDYSAKKAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHETDIAFCEYLIKEVGVVAIPTSVFY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQCQCTWTCCESKMLKPSAFGSSFSSSALLSFSKHLHTISITDSANTRRRGISTTCPRYPSLMASLSTVSTNQSDTIQKTNLQPQQVAKRLEKFKTTIFTQMSMLAIKHGAINLGQGFPNFDGPDFVKDAAIQAIRDGKNQYARGHGVPEFNSAIASRFKKDSGLEVDPEKEVTVTSGCTEAIAATILGLINPGDEVILFAPFYDSYEATLSMAGAKIKCITLRPPDFAIPIEELKSTISKNTRAILMNTPHNPTGKMFTREELNVIASLCIENDVLVFSDEVYDKLAFEMDHISIASLPGMYERTVTMNSLGKTFSLTGWKIGWAIAPPHLTWGVRQAHSFLTFATSTPMQWAATAALRAPETYYEELKRDYSAKKAILVEGLNAVGFKVFPSSGTYFVVVDHTPFGHETDIAFCEYLIKEVGVVAIPTSVFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Kynurenine--oxoglutarate transaminase 3 Catalyzes the irreversible transamination of the L-tryptophan metabolite L-kynurenine to form kynurenic acid (KA). May catalyze the beta-elimination of S-conjugates and Se-conjugates of L-(seleno)cysteine, resulting in the cleavage of the C-S or C-Se bond (By similarity). Has transaminase activity towards L-kynurenine, tryptophan, phenylalanine, serine, cysteine, methionine, histidine, glutamine and asparagine with glyoxylate as an amino group acceptor (in vitro). Has lower activity with 2-oxoglutarate as amino group acceptor (in vitro).probableQ7T3E5

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O0R, chain A
Confidence level:very confident
Coverage over the Query: 93-433
View the alignment between query and template
View the model in PyMOL
Template: 1YIY, chain A
Confidence level:confident
Coverage over the Query: 84-434
View the alignment between query and template
View the model in PyMOL