Citrus Sinensis ID: 013900

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430----

MGNTESGYDDDSHEYFRHQRPSYGGSSMDHNYQPWSYTESSMDHSHQPTSYAGSSAHHSHQPMSYAGSSAHHNYQRPQQATRFADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVNGELVAGPRTRLLPPPREVIDHDNVVKSIPHMTNFETVEATALVEPVCPICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRLRLYT

ccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEccccccHHHHHHHHHHHccccEEcEEEEEEccccccccccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccEEccccccccccHHHHHHHHHHHcccEEEccccccHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHcHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccEEcccccccHHHHccccccccccccccccccccc

ccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcEccccccHHHHHHHHHHHccccEEEEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccEccccccccccHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHccccEEEEEEEEccEEEEccccccccccccHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHcccccHHHHccEEEEcHHHHHcccccHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccHHHcccccccccccccccEEEEEEEc

mgntesgydddsheyfrhqrpsyggssmdhnyqpwsytessmdhshqptsyagssahhshqpmsyagssahhnyqrpqqatrfadnYNTLDEVISALREAGlessnlilgidftksnewtgkysfNRKSLHAISNIRNPYEQAISIIgrtlspfdednlipcfgfgdasthdqyvfsfypdnhychgFEEVLARYREILphlklsgptsfapiIDAAIDIVEASNRQYHVLVIIAdgqvtrnpdtpagrlspqeqatVNSIVAASHYPLSIILVGvgdgpwdsvqqfddnipqrafdnfqfVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSvngelvagprtrllppprevidhdnvvksiphmtnfetveatalvepvcpicltnpkdmafgcghttckdcgttisscpmcrepittrlrlyt

mgntesgydddsheYFRHQRPSYGGSSMDHNYQPWSYTESSMDHSHQPTSYAGSSAHHSHQPMSYAGSSAHHNYQRPQQATRFADNYNTLDEVISALREAGLESSNLILGIdftksnewtgKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVNGELVAGprtrllppprevIDHDNVVKSIPHMTNFETVEATALVEPVCPICLTNPKDMAFGCGHTTCKDcgttisscpmcrepittrlrlyt

**********************************************************************************FADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQV******************VNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIM**********AAFALAALMEIPLQYKATLSLHSVNGELVAGPRTRLLPPPREVIDHDNVVKSIPHMTNFETVEATALVEPVCPICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRL****

***************************MDHNYQPWSYTESSMDH*HQ**********************************RFADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTG*YSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQVTRNPDT******PQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVNGELVAGPRTRLLPPPREVIDHDNV**********************CPICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRLRLYT

***********SHEYFRHQRPSYGGSSMDHNYQPWSYT**************************************PQQATRFADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVNGELVAGPRTRLLPPPREVIDHDNVVKSIPHMTNFETVEATALVEPVCPICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRLRLYT

*****************HQRPSY**************************************************YQRPQQATRFADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVNG******************************************EPVCPICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRLRLYT

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		434	2.2.26 [Sep-21-2011]
Q9SS90		489	E3 ubiquitin-protein liga	no	no	0.866	0.768	0.600	1e-134
Q9LY87		468	E3 ubiquitin-protein liga	no	no	0.870	0.807	0.586	1e-127
Q09221		7705	Copine family protein 2 O	no	no	0.557	0.031	0.496	4e-67
Q99829		537	Copine-1 OS=Homo sapiens	yes	no	0.513	0.415	0.322	4e-25
Q8C166		536	Copine-1 OS=Mus musculus	yes	no	0.520	0.421	0.329	1e-24
Q8BT60		533	Copine-3 OS=Mus musculus	no	no	0.502	0.409	0.339	5e-22
O75131		537	Copine-3 OS=Homo sapiens	no	no	0.502	0.405	0.328	7e-22
Q96FN4		548	Copine-2 OS=Homo sapiens	no	no	0.465	0.368	0.308	2e-21
Q5RAE1		537	Copine-3 OS=Pongo abelii	no	no	0.502	0.405	0.332	3e-21
P59108		548	Copine-2 OS=Mus musculus	no	no	0.504	0.399	0.308	1e-20

>sp\|Q9SS90\|RGLG1_ARATH E3 ubiquitin-protein ligase RGLG1 OS=Arabidopsis thaliana GN=RGLG1 PE=1 SV=1	Back alignment and function desciption

 Score =  478 bits (1229), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 242/403 (60%), Positives = 299/403 (74%), Gaps = 27/403 (6%)

Query: 54  SSAHHSHQPMSYAGSSAHHNYQRP-------------QQATRFADNYNTLDEVISALREA 100
           SS  H +    YA +++  NY  P             ++ ++ +DNY++L +V  AL  A
Sbjct: 91  SSYGHQYSQEGYASAASQPNYPPPPSQSQVADRKKFDRRYSKISDNYSSLLQVSEALGRA 150

Query: 101 GLESSNLILGIDFTKSNEWTGKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLI 160
           GLESSNLI+GIDFTKSNEWTG  SFNRKSLH +SN  NPYEQAI+IIGRTL+ FDEDNLI
Sbjct: 151 GLESSNLIVGIDFTKSNEWTGAKSFNRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLI 210

Query: 161 PCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDI 220
           PC+GFGDASTHDQ VFSFYP+  +C+GFEEVLARYREI+P LKL+GPTSFAPII+ A+ +
Sbjct: 211 PCYGFGDASTHDQDVFSFYPEGRFCNGFEEVLARYREIVPQLKLAGPTSFAPIIEMAMTV 270

Query: 221 VEASNRQYHVLVIIADGQVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGP 280
           VE S+ QYHVLVIIADGQVTR+ DT  GRLSPQEQ TV++IV AS  PLSI+LVGVGDGP
Sbjct: 271 VEQSSGQYHVLVIIADGQVTRSVDTEHGRLSPQEQKTVDAIVKASTLPLSIVLVGVGDGP 330

Query: 281 WDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLH 340
           WD +Q+FDDNIP RAFDNFQFVNFT+IMS+NK+ S+KE  FAL+ALMEIP QYKAT+ L+
Sbjct: 331 WDMMQEFDDNIPARAFDNFQFVNFTEIMSKNKDQSRKETEFALSALMEIPPQYKATIELN 390

Query: 341 SV---NGELVAGPRTRLLPPPREVIDHD------NVVKSIPHMTNFETVEATALVE-PVC 390
            +   NG +   P+   LPPP +           N   S+P    FE+ + ++  +  +C
Sbjct: 391 LLGVRNGNI---PQRIPLPPPVQSGSSFSSSRIPNFEPSVPPYP-FESKQMSSADDIQLC 446

Query: 391 PICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRLRLY 433
           PICL+NPK+MAFGCGH TC +CG  +  CP+CR PI TR++LY
Sbjct: 447 PICLSNPKNMAFGCGHQTCCECGPDLKVCPICRAPIQTRIKLY 489

E3 ubiquitin-protein ligase that mediates the formation of 'Lys-63'-linked multiubiquitin chains. Regulates apical dominance by acting on the auxin transport proteins abundance.
Arabidopsis thaliana (taxid: 3702)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -

>sp\|Q9LY87\|RGLG2_ARATH E3 ubiquitin-protein ligase RGLG2 OS=Arabidopsis thaliana GN=RGLG2 PE=1 SV=1	Back alignment and function description

>sp\|Q09221\|CPNA2_CAEEL Copine family protein 2 OS=Caenorhabditis elegans GN=cpna-2 PE=2 SV=4	Back alignment and function description

>sp\|Q99829\|CPNE1_HUMAN Copine-1 OS=Homo sapiens GN=CPNE1 PE=1 SV=1	Back alignment and function description

>sp\|Q8C166\|CPNE1_MOUSE Copine-1 OS=Mus musculus GN=Cpne1 PE=1 SV=1	Back alignment and function description

>sp\|Q8BT60\|CPNE3_MOUSE Copine-3 OS=Mus musculus GN=Cpne3 PE=1 SV=2	Back alignment and function description

>sp\|O75131\|CPNE3_HUMAN Copine-3 OS=Homo sapiens GN=CPNE3 PE=1 SV=1	Back alignment and function description

>sp\|Q96FN4\|CPNE2_HUMAN Copine-2 OS=Homo sapiens GN=CPNE2 PE=1 SV=3	Back alignment and function description

>sp\|Q5RAE1\|CPNE3_PONAB Copine-3 OS=Pongo abelii GN=CPNE3 PE=2 SV=1	Back alignment and function description

>sp\|P59108\|CPNE2_MOUSE Copine-2 OS=Mus musculus GN=Cpne2 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		434
356512854		426	PREDICTED: E3 ubiquitin-protein ligase R	0.970	0.988	0.715	1e-177
357464723		432	E3 ubiquitin-protein ligase mib1 [Medica	0.970	0.974	0.707	1e-173
356508955		432	PREDICTED: E3 ubiquitin-protein ligase R	0.986	0.990	0.696	1e-173
224081008		351	predicted protein [Populus trichocarpa]	0.797	0.985	0.805	1e-170
225431693		393	PREDICTED: E3 ubiquitin-protein ligase R	0.896	0.989	0.675	1e-167
359477061		367	PREDICTED: E3 ubiquitin-protein ligase R	0.829	0.980	0.754	1e-162
224093474		364	predicted protein [Populus trichocarpa]	0.834	0.994	0.807	1e-161
22328041		367	Copine (Calcium-dependent phospholipid-b	0.820	0.970	0.726	1e-156
449518765		364	PREDICTED: E3 ubiquitin-protein ligase R	0.806	0.961	0.749	1e-152
255550530		378	copine, putative [Ricinus communis] gi\|2	0.824	0.947	0.754	1e-152

>gi\|356512854\|ref\|XP_003525130.1\| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Glycine max]	Back alignment and taxonomy information

 Score =  628 bits (1619), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 314/439 (71%), Positives = 353/439 (80%), Gaps = 18/439 (4%)

Query: 1   MGNTESGYDDDSHEYFRHQRPSYGGSSMDHNYQPWSYTESSMDHSHQPTSYAGSSA---H 57
           MGN ES +D  SH+ F  Q  S+ GSS + ++Q            HQP SY GSSA   H
Sbjct: 1   MGNEESTHD--SHDDFFRQPRSHDGSSPNTSHQ-----------YHQPPSYDGSSANTSH 47

Query: 58  HSHQPMSYAGSSAHHNYQRPQQATRFADNYNTLDEVISALREAGLESSNLILGIDFTKSN 117
             HQP SYAGSS +  +Q  Q+ T  AD++++LD+V+SALREAGLESSNLI+GIDFTKSN
Sbjct: 48  QYHQPSSYAGSSVNTRHQYKQRPTYIADSFSSLDQVVSALREAGLESSNLIIGIDFTKSN 107

Query: 118 EWTGKYSFNRKSLHAISNIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFS 177
           EWTGK+SFN KSLH   N  NPYEQAISIIGRTLS FDEDNLIPCFGFGDASTHDQ VFS
Sbjct: 108 EWTGKHSFNHKSLHFTGNTPNPYEQAISIIGRTLSSFDEDNLIPCFGFGDASTHDQNVFS 167

Query: 178 FYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADG 237
           FYPD  YCHGFE+VLARYREI+PHLKL+GPTSFAP+IDAA+ IVE SN QYHVLVIIADG
Sbjct: 168 FYPDECYCHGFEQVLARYREIVPHLKLAGPTSFAPVIDAAVGIVERSNGQYHVLVIIADG 227

Query: 238 QVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFD 297
           QVTRN DTP G+ SPQEQAT+NSI+AASHYPLSIILVGVGDGPWD +Q FDDNI QR FD
Sbjct: 228 QVTRNSDTPHGKFSPQEQATINSIIAASHYPLSIILVGVGDGPWDEMQHFDDNITQRLFD 287

Query: 298 NFQFVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVNGELVAGPRTRLLPP 357
           NFQFVNFTKI SENK+ SKKEAAFALAALMEIP+QY+ T +L   N    +  R R LPP
Sbjct: 288 NFQFVNFTKITSENKDASKKEAAFALAALMEIPIQYRITQNLQIANENPTSHQRKRPLPP 347

Query: 358 PREVIDHDNVVKSIPHMTNFETVE--ATALVEPVCPICLTNPKDMAFGCGHTTCKDCGTT 415
           P+EVID DN V ++PH+ NFE+VE  A A VE VCPICLTNPKDMAFGCGHTTCK+CG T
Sbjct: 348 PKEVIDRDNAVLAVPHVPNFESVEPSAPAAVESVCPICLTNPKDMAFGCGHTTCKECGVT 407

Query: 416 ISSCPMCREPITTRLRLYT 434
           +SSCPMCR+ ITTRLRLYT
Sbjct: 408 LSSCPMCRQEITTRLRLYT 426

Source: Glycine max

Species: Glycine max

Genus: Glycine

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|357464723\|ref\|XP_003602643.1\| E3 ubiquitin-protein ligase mib1 [Medicago truncatula] gi\|355491691\|gb\|AES72894.1\| E3 ubiquitin-protein ligase mib1 [Medicago truncatula]	Back alignment and taxonomy information

>gi\|356508955\|ref\|XP_003523218.1\| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Glycine max]	Back alignment and taxonomy information

>gi\|224081008\|ref\|XP_002306262.1\| predicted protein [Populus trichocarpa] gi\|222855711\|gb\|EEE93258.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|225431693\|ref\|XP_002266834.1\| PREDICTED: E3 ubiquitin-protein ligase RGLG1 isoform 1 [Vitis vinifera] gi\|359477063\|ref\|XP_003631931.1\| PREDICTED: E3 ubiquitin-protein ligase RGLG1 isoform 3 [Vitis vinifera]	Back alignment and taxonomy information

>gi\|359477061\|ref\|XP_003631930.1\| PREDICTED: E3 ubiquitin-protein ligase RGLG1 isoform 2 [Vitis vinifera] gi\|296088522\|emb\|CBI37513.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi\|224093474\|ref\|XP_002309925.1\| predicted protein [Populus trichocarpa] gi\|118486339\|gb\|ABK95010.1\| unknown [Populus trichocarpa] gi\|222852828\|gb\|EEE90375.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi|22328041|ref|NP_201202.2| Copine (Calcium-dependent phospholipid-binding protein) family [Arabidopsis thaliana] gi|79332056|ref|NP_001032132.1| Copine (Calcium-dependent phospholipid-binding protein) family [Arabidopsis thaliana] gi|20259326|gb|AAM13989.1| unknown protein [Arabidopsis thaliana] gi|21689819|gb|AAM67553.1| unknown protein [Arabidopsis thaliana] gi|332010440|gb|AED97823.1| Copine (Calcium-dependent phospholipid-binding protein) family [Arabidopsis thaliana] gi|332010441|gb|AED97824.1| Copine (Calcium-dependent phospholipid-binding protein) family [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|449518765\|ref\|XP_004166406.1\| PREDICTED: E3 ubiquitin-protein ligase RGLG1-like [Cucumis sativus]	Back alignment and taxonomy information

>gi\|255550530\|ref\|XP_002516315.1\| copine, putative [Ricinus communis] gi\|223544545\|gb\|EEF46062.1\| copine, putative [Ricinus communis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		434
TAIR\|locus:2160821		367	RGLG3 "RING DOMAIN LIGASE 3" [	0.824	0.975	0.725	9.6e-144
TAIR\|locus:2084218		489	RGLG1 "RING domain ligase1" [A	0.914	0.811	0.594	1.3e-123
TAIR\|locus:2145643		468	RGLG2 "RING domain ligase2" [A	0.764	0.709	0.616	1.4e-120
TAIR\|locus:2008570		453	AT1G67800 [Arabidopsis thalian	0.947	0.907	0.551	8.2e-115
TAIR\|locus:2206395		401	RGLG4 "RING DOMAIN LIGASE 4" [	0.861	0.932	0.573	5.2e-113
DICTYBASE\|DDB_G0272196		284	DDB_G0272196 "copine family pr	0.610	0.933	0.486	2e-63
WB\|WBGene00006495		1107	cpna-1 [Caenorhabditis elegans	0.548	0.214	0.460	5.7e-53
UNIPROTKB\|E2R9N5		537	CPNE1 "Uncharacterized protein	0.516	0.417	0.345	7.5e-24
MGI\|MGI:2386621		536	Cpne1 "copine I" [Mus musculus	0.472	0.382	0.349	7.4e-23
UNIPROTKB\|F1S4V8		537	CPNE1 "Uncharacterized protein	0.516	0.417	0.338	7.5e-23

TAIR\|locus:2160821 RGLG3 "RING DOMAIN LIGASE 3" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1405 (499.6 bits), Expect = 9.6e-144, P = 9.6e-144
 Identities = 264/364 (72%), Positives = 309/364 (84%)

Query:    75 QRPQQATRFADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAIS 134
             +R QQ +  AD++++LD+VI++LREAGLESSNLILGIDFTKSNEWTG+YSFNRKSLHAI 
Sbjct:     6 KRNQQPSYIADHFSSLDQVITSLREAGLESSNLILGIDFTKSNEWTGRYSFNRKSLHAIG 65

Query:   135 NIRNPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYPDNHYCHGFEEVLAR 194
               +NPYE+AISIIGRTLSPFDED+LIPCFGFGD +T DQYVFSFYP+N  C G E  + R
Sbjct:    66 KRQNPYEKAISIIGRTLSPFDEDDLIPCFGFGDVTTRDQYVFSFYPENKSCDGLENAVKR 125

Query:   195 YREILPHLKLSGPTSFAPIIDAAIDIVEASNRQYHVLVIIADGQVTRNPDTPAGRLSPQE 254
             YREI+PHLKLSGPTSFAP+IDAAI+IVE +N QYHVLVIIADGQVTRNPD P GRLSPQE
Sbjct:   126 YREIVPHLKLSGPTSFAPVIDAAINIVEQNNMQYHVLVIIADGQVTRNPDVPLGRLSPQE 185

Query:   255 QATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQRAFDNFQFVNFTKIMSENKET 314
             +AT+NSI+AASHYPLSI+LVGVGDGPWD+++QFDDNIP R FDNFQFVNFTKIMSE+K+ 
Sbjct:   186 EATMNSIMAASHYPLSIVLVGVGDGPWDTMKQFDDNIPHREFDNFQFVNFTKIMSEHKDA 245

Query:   315 SKKEAAFALAALMEIPLQYKATLSLHSVNGELVAGPRTRLLPPPREVIDHDNVVKSIPHM 374
             +KKEAAFALAALMEIP QYKATLSL+       +    + LPPP EVI+ DN V+S+P+ 
Sbjct:   246 AKKEAAFALAALMEIPFQYKATLSLNR-KPVRSSHQHHKPLPPPPEVIERDNAVRSVPNQ 304

Query:   375 TNFETVEATALVEP----VCPICLTNPKDMAFGCGHTTCKDCGTTISSCPMCREPITTRL 430
                ET E +  + P    VCPICLTNPKDMAF CGHTTCK+CG  I++CP+CR+PITTR+
Sbjct:   305 MT-ETAEKSDRLAPSTVPVCPICLTNPKDMAFSCGHTTCKECGVVITTCPLCRQPITTRI 363

Query:   431 RLYT 434
             RLYT
Sbjct:   364 RLYT 367

GO:0005886 "plasma membrane" evidence=ISM

GO:0008150 "biological_process" evidence=ND

GO:0008270 "zinc ion binding" evidence=IEA

GO:0009690 "cytokinin metabolic process" evidence=RCA

GO:0004842 "ubiquitin-protein ligase activity" evidence=IDA

GO:0009611 "response to wounding" evidence=IMP

GO:0009867 "jasmonic acid mediated signaling pathway" evidence=IMP

GO:0042742 "defense response to bacterium" evidence=IMP

TAIR\|locus:2084218 RGLG1 "RING domain ligase1" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2145643 RGLG2 "RING domain ligase2" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2008570 AT1G67800 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2206395 RGLG4 "RING DOMAIN LIGASE 4" [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0272196 DDB_G0272196 "copine family protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

WB\|WBGene00006495 cpna-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R9N5 CPNE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

MGI\|MGI:2386621 Cpne1 "copine I" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|F1S4V8 CPNE1 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
3rd Layer	6.3.2	LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		434
cd01459		254	cd01459, vWA_copine_like, VWA Copine: Copines are	1e-108
pfam07002		146	pfam07002, Copine, Copine	3e-69
pfam13920		49	pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI	3e-11
pfam13923		45	pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI	5e-09
cd00162		45	cd00162, RING, RING-finger (Really Interesting New	4e-08
smart00327		175	smart00327, VWA, von Willebrand factor (vWF) type	2e-07
pfam00097		40	pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING	2e-06
smart00184		40	smart00184, RING, Ring finger	2e-05
pfam13639		46	pfam13639, zf-RING_2, Ring finger domain	1e-04

>gnl\|CDD\|238736 cd01459, vWA_copine_like, VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium	Back alignment and domain information

 Score =  319 bits (819), Expect = e-108
 Identities = 127/272 (46%), Positives = 159/272 (58%), Gaps = 43/272 (15%)

Query: 85  DNYNTLDEVI----------SALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAIS 134
             Y +  EV              R AGLES NLI+ IDFTKSN W G+     +SLH IS
Sbjct: 3   KVYKSSGEVTLTDCRVQPTFLDYRSAGLES-NLIVAIDFTKSNGWPGEK----RSLHYIS 57

Query: 135 NIR-NPYEQAISIIGRTLSPFDEDNLIPCFGFGDASTHDQYVFSFYP---DNHYCHGFEE 190
             R NPY++AI I+G  L P+D D LIP FGFG   T DQ VFSF+P   ++  C GFE 
Sbjct: 58  PGRLNPYQKAIRIVGEVLQPYDSDKLIPAFGFGAIVTKDQSVFSFFPGYSESPECQGFEG 117

Query: 191 VLARYREILPHLKLSGPTSFAPIIDAAIDIVEASNRQ--YHVLVIIADGQVTRNPDTPAG 248
           VL  YRE LP++ LSGPT+FAP+I AA +I +ASN Q  YH+L+II DG++T        
Sbjct: 118 VLRAYREALPNVSLSGPTNFAPVIRAAANIAKASNSQSKYHILLIITDGEITDM------ 171

Query: 249 RLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDD-------NIPQRAFDNFQF 301
                   T+ +IV AS YPLSI++VGVGDGP+D++++ DD       +      D  QF
Sbjct: 172 ------NETIKAIVEASKYPLSIVIVGVGDGPFDAMERLDDDDGLESSDGRIATRDIVQF 225

Query: 302 VNFTKIMSENKETSKKEAAFALAALMEIPLQY 333
           V FT+ MS        EAA A AAL EIP Q 
Sbjct: 226 VPFTEFMSNAG---NPEAALATAALAEIPSQL 254

They are found in human and orthologues have been found in C. elegans and Arabidopsis Thaliana. None have been found in D. Melanogaster or S. Cereviciae. Phylogenetic distribution suggests that copines have been lost in some eukaryotes. No functional properties have been assigned to the VWA domains present in copines. The members of this subgroup contain a functional MIDAS motif based on their preferential binding to magnesium and manganese. However, the MIDAS motif is not totally conserved, in most cases the MIDAS consists of the sequence DxTxS instead of the motif DxSxS that is found in most cases. The C2 domains present in copines mediate phospholipid binding. Length = 254

>gnl\|CDD\|219263 pfam07002, Copine, Copine	Back alignment and domain information

>gnl\|CDD\|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>gnl\|CDD\|214621 smart00327, VWA, von Willebrand factor (vWF) type A domain	Back alignment and domain information

>gnl\|CDD\|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger)	Back alignment and domain information

>gnl\|CDD\|214546 smart00184, RING, Ring finger	Back alignment and domain information

>gnl\|CDD\|222279 pfam13639, zf-RING_2, Ring finger domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		434
KOG1327		529	consensus Copine [Signal transduction mechanisms]	100.0
cd01459		254	vWA_copine_like VWA Copine: Copines are phospholip	100.0
PF07002		146	Copine: Copine; InterPro: IPR010734 This represent	100.0
PF10138		200	vWA-TerF-like: vWA found in TerF C terminus ; Inte	99.96
cd01457		199	vWA_ORF176_type VWA ORF176 type: Von Willebrand fa	99.79
smart00327		177	VWA von Willebrand factor (vWF) type A domain. VWA	98.68
KOG0320		187	consensus Predicted E3 ubiquitin ligase [Posttrans	98.67
PF13920		50	zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger);	98.51
PLN03208		193	E3 ubiquitin-protein ligase RMA2; Provisional	98.47
KOG0823		230	consensus Predicted E3 ubiquitin ligase [Posttrans	98.47
cd01461		171	vWA_interalpha_trypsin_inhibitor vWA_interalpha tr	98.46
PF15227		42	zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB:	98.35
KOG0317		293	consensus Predicted E3 ubiquitin ligase, integral	98.35
cd00198		161	vWFA Von Willebrand factor type A (vWA) domain was	98.34
cd01463		190	vWA_VGCC_like VWA Voltage gated Calcium channel li	98.32
KOG4172		62	consensus Predicted E3 ubiquitin ligase [Posttrans	98.27
cd01471		186	vWA_micronemal_protein Micronemal proteins: The To	98.25
PHA02929		238	N1R/p28-like protein; Provisional	98.19
cd01450		161	vWFA_subfamily_ECM Von Willebrand factor type A (v	98.16
cd01464		176	vWA_subfamily VWA subfamily: Von Willebrand factor	98.16
KOG4275		350	consensus Predicted E3 ubiquitin ligase [Posttrans	98.15
PF13519		172	VWA_2: von Willebrand factor type A domain; PDB: 3	98.05
cd01466		155	vWA_C3HC4_type VWA C3HC4-type: Von Willebrand fact	98.04
KOG2164		513	consensus Predicted E3 ubiquitin ligase [Posttrans	98.03
cd01465		170	vWA_subgroup VWA subgroup: Von Willebrand factor t	98.01
PF13639		44	zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C	98.01
TIGR00599		397	rad18 DNA repair protein rad18. This family is bas	98.0
smart00504		63	Ubox Modified RING finger domain. Modified RING fi	97.99
PHA02926		242	zinc finger-like protein; Provisional	97.97
cd01454		174	vWA_norD_type norD type: Denitrifying bacteria con	97.96
PF13923		39	zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger);	97.94
KOG4265		349	consensus Predicted E3 ubiquitin ligase [Posttrans	97.85
cd01482		164	vWA_collagen_alphaI-XII-like Collagen: The extrace	97.83
PF14634		44	zf-RING_5: zinc-RING finger domain	97.82
cd01456		206	vWA_ywmD_type VWA ywmD type:Von Willebrand factor	97.79
cd01476		163	VWA_integrin_invertebrates VWA_integrin (invertebr	97.73
KOG2177		386	consensus Predicted E3 ubiquitin ligase [Posttrans	97.72
cd01473		192	vWA_CTRP CTRP for CS protein-TRAP-related protein:	97.71
cd01472		164	vWA_collagen von Willebrand factor (vWF) type A do	97.7
cd01467		180	vWA_BatA_type VWA BatA type: Von Willebrand factor	97.7
COG5574		271	PEX10 RING-finger-containing E3 ubiquitin ligase [	97.69
TIGR03788		596	marine_srt_targ marine proteobacterial sortase tar	97.69
cd00162		45	RING RING-finger (Really Interesting New Gene) dom	97.66
PF00097		41	zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I	97.65
KOG0978		698	consensus E3 ubiquitin ligase involved in syntaxin	97.6
PF13768		155	VWA_3: von Willebrand factor type A domain	97.59
cd01470		198	vWA_complement_factors Complement factors B and C2	97.55
KOG0287		442	consensus Postreplication repair protein RAD18 [Re	97.51
KOG1571		355	consensus Predicted E3 ubiquitin ligase [Posttrans	97.51
COG5432		391	RAD18 RING-finger-containing E3 ubiquitin ligase [	97.49
smart00184		39	RING Ring finger. E3 ubiquitin-protein ligase acti	97.44
PF14835		65	zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM	97.42
KOG0311		381	consensus Predicted E3 ubiquitin ligase [Posttrans	97.42
cd01480		186	vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI	97.4
PTZ00441		576	sporozoite surface protein 2 (SSP2); Provisional	97.37
PF00092		178	VWA: von Willebrand factor type A domain; InterPro	97.37
cd01475		224	vWA_Matrilin VWA_Matrilin: In cartilaginous plate,	97.31
PF13445		43	zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A.	97.3
cd01462		152	VWA_YIEM_type VWA YIEM type: Von Willebrand factor	97.29
cd01474		185	vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxi	97.28
PF04564		73	U-box: U-box domain; InterPro: IPR003613 Quality c	97.26
COG5540		374	RING-finger-containing ubiquitin ligase [Posttrans	97.24
cd01453		183	vWA_transcription_factor_IIH_type Transcription fa	97.21
KOG4628		348	consensus Predicted E3 ubiquitin ligase [Posttrans	97.21
KOG1785		563	consensus Tyrosine kinase negative regulator CBL [	97.0
cd01469		177	vWA_integrins_alpha_subunit Integrins are a class	97.0
KOG0804		493	consensus Cytoplasmic Zn-finger protein BRAP2 (BRC	96.97
cd01460		266	vWA_midasin VWA_Midasin: Midasin is a member of th	96.97
cd01477		193	vWA_F09G8-8_type VWA F09G8.8 type: Von Willebrand	96.93
cd01451		178	vWA_Magnesium_chelatase Magnesium chelatase: Mg-ch	96.87
cd01481		165	vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(V	96.86
PF12678		73	zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766	96.73
PRK13685		326	hypothetical protein; Provisional	96.7
PF09967		126	DUF2201: VWA-like domain (DUF2201); InterPro: IPR0	96.7
cd01455		191	vWA_F11C1-5a_type Von Willebrand factor type A (vW	96.61
cd01452		187	VWA_26S_proteasome_subunit 26S proteasome plays a	96.54
cd01458		218	vWA_ku Ku70/Ku80 N-terminal domain. The Ku78 heter	96.53
COG5243		491	HRD1 HRD ubiquitin ligase complex, ER membrane com	96.53
KOG2879		298	consensus Predicted E3 ubiquitin ligase [Posttrans	96.44
PRK13406		584	bchD magnesium chelatase subunit D; Provisional	96.43
KOG1100		207	consensus Predicted E3 ubiquitin ligase [Posttrans	96.43
KOG0802		543	consensus E3 ubiquitin ligase [Posttranslational m	96.13
KOG4159		398	consensus Predicted E3 ubiquitin ligase [Posttrans	96.05
TIGR03436		296	acidobact_VWFA VWFA-related Acidobacterial domain.	96.04
TIGR02031		589	BchD-ChlD magnesium chelatase ATPase subunit D. Th	95.98
PF14447		55	Prok-RING_4: Prokaryotic RING finger family 4	95.96
PF12861		85	zf-Apc11: Anaphase-promoting complex subunit 11 RI	95.68
KOG1039		344	consensus Predicted E3 ubiquitin ligase [Posttrans	95.47
TIGR02442		633	Cob-chelat-sub cobaltochelatase subunit. A number	95.27
KOG0826		357	consensus Predicted E3 ubiquitin ligase involved i	95.26
COG5152		259	Uncharacterized conserved protein, contains RING a	95.15
COG5236		493	Uncharacterized conserved protein, contains RING Z	94.87
KOG0297		391	consensus TNF receptor-associated factor [Signal t	94.77
KOG2660		331	consensus Locus-specific chromosome binding protei	94.75
PRK10997		487	yieM hypothetical protein; Provisional	94.66
KOG1813		313	consensus Predicted E3 ubiquitin ligase [Posttrans	94.6
KOG0825		1134	consensus PHD Zn-finger protein [General function	94.32
KOG0828		636	consensus Predicted E3 ubiquitin ligase [Posttrans	94.27
COG5222		427	Uncharacterized conserved protein, contains RING Z	94.26
KOG4692		489	consensus Predicted E3 ubiquitin ligase [Posttrans	94.17
PF04641		260	Rtf2: Rtf2 RING-finger	94.12
PF05762		222	VWA_CoxE: VWA domain containing CoxE-like protein;	93.48
KOG3002		299	consensus Zn finger protein [General function pred	93.47
KOG1002		791	consensus Nucleotide excision repair protein RAD16	93.37
TIGR00868		863	hCaCC calcium-activated chloride channel protein 1	92.84
COG5175		480	MOT2 Transcriptional repressor [Transcription]	92.76
KOG3039		303	consensus Uncharacterized conserved protein [Funct	92.74
KOG1734		328	consensus Predicted RING-containing E3 ubiquitin l	92.65
PF14570		48	zf-RING_4: RING/Ubox like zinc-binding domain; PDB	91.9
PF11789		57	zf-Nse: Zinc-finger of the MIZ type in Nse subunit	89.72
KOG1001		674	consensus Helicase-like transcription factor HLTF/	88.67
KOG2932		389	consensus E3 ubiquitin ligase involved in ubiquiti	88.22
PF10367		109	Vps39_2: Vacuolar sorting protein 39 domain 2; Int	87.88
KOG1493		84	consensus Anaphase-promoting complex (APC), subuni	87.14
PF11793		70	FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A.	86.12
COG1240		261	ChlD Mg-chelatase subunit ChlD [Coenzyme metabolis	85.73
COG2425		437	Uncharacterized protein containing a von Willebran	85.43
COG5219		1525	Uncharacterized conserved protein, contains RING Z	85.25
COG4245		207	TerY Uncharacterized protein encoded in toxicity p	84.75
KOG4445		368	consensus Uncharacterized conserved protein, conta	82.03
KOG1814		445	consensus Predicted E3 ubiquitin ligase [Posttrans	81.57
KOG2114		933	consensus Vacuolar assembly/sorting protein PEP5/V	80.96
COG5194		88	APC11 Component of SCF ubiquitin ligase and anapha	80.37

>KOG1327 consensus Copine [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=7.7e-80  Score=641.34  Aligned_cols=251  Identities=44%  Similarity=0.676  Sum_probs=235.0

Q ss_pred             cccccccccccCCHHHHHHHHHHcCCceeceEEEEecCCCCCCCCCCCCCCCCccccC-CCCCHHHHHHHHHhhcccccC
Q 013900           77 PQQATRFADNYNTLDEVISALREAGLESSNLILGIDFTKSNEWTGKYSFNRKSLHAIS-NIRNPYEQAISIIGRTLSPFD  155 (434)
Q Consensus        77 ~~~~~~i~~~~~~~~~~~~~l~~~Gl~~~nlivaIDFT~SN~~~g~~~~~~~SLH~i~-~~~N~Ye~AI~~Ig~vl~~yD  155 (434)
                      +.++..+.++|+++++++-++..+|++++||+||||||+||+|++.+    .|||||+ ..+|+||+||++||+||++||
T Consensus       258 k~~g~~~l~~~~~~~~~sfld~i~gg~~lnf~vgIDfTaSNg~p~~~----sSLHyi~p~~~N~Y~~Ai~~vG~~lq~yd  333 (529)
T KOG1327|consen  258 KNSGQLILDRFTSLDQYSFLDYIAGGEQLNFTVGIDFTASNGDPRNP----SSLHYIDPHQPNPYEQAIRSVGETLQDYD  333 (529)
T ss_pred             cccceEEehheeehhhhhHHHHHccCceeeeEEEEEEeccCCCCCCC----CcceecCCCCCCHHHHHHHHHhhhhcccC
Confidence            33788899999999999999999999999999999999999999864    5999999 479999999999999999999


Q ss_pred             CCCCcceEeeCCCCCC---CCc--ceecCCCCCCcCCHHHHHHHHHHhcCCccccCCCChHHHHHHHHHHHHHcc---Cc
Q 013900          156 EDNLIPCFGFGDASTH---DQY--VFSFYPDNHYCHGFEEVLARYREILPHLKLSGPTSFAPIIDAAIDIVEASN---RQ  227 (434)
Q Consensus       156 ~d~~ip~~GFGa~~~~---~~~--vf~~~~~~~~~~G~egvl~~Yr~~~~~v~l~GPT~fapiI~~a~~~~~~~~---~~  227 (434)
                      +||+||||||||+.+.   .++  +|+|++.|++|+||+|||+|||+++|+|+|+|||+|||||++|+++|+++.   .+
T Consensus       334 sdk~fpa~GFGakip~~~~vs~~f~ln~~~~~~~c~Gi~gVl~aY~~~lp~v~l~GPTnFaPII~~va~~a~~~~~~~~q  413 (529)
T KOG1327|consen  334 SDKLFPAFGFGAKIPPDGQVSHEFVLNFNPEDPECRGIEGVLEAYRKALPNVQLYGPTNFSPIINHVARIAQQSGNTAGQ  413 (529)
T ss_pred             CCCccccccccccCCCCcccccceeecCCCCCCccccHHHHHHHHHhhcccccccCCCccHHHHHHHHHHHHHhccCCcc
Confidence            9999999999999766   355  456678999999999999999999999999999999999999999999886   89


Q ss_pred             cEEEEEEeCCcccCCCCCCCCCCChhHHHHHHHHHHhccCCcEEEEEecccCCcccccccCCCCCc-------cccccee
Q 013900          228 YHVLVIIADGQVTRNPDTPAGRLSPQEQATVNSIVAASHYPLSIILVGVGDGPWDSVQQFDDNIPQ-------RAFDNFQ  300 (434)
Q Consensus       228 Y~VLlIiTDG~i~d~~~~~~~~~~~~~~~T~~aIv~AS~~PLSIIiVGVGd~~f~~m~~lD~~~~~-------r~rDnvq  300 (434)
                      ||||||||||+|||            |++|++|||.||++|||||||||||+||++|++||++++.       |.|||||
T Consensus       414 Y~VLlIitDG~vTd------------m~~T~~AIV~AS~lPlSIIiVGVGd~df~~M~~lD~d~~~l~~~gr~~~rD~vQ  481 (529)
T KOG1327|consen  414 YHVLLIITDGVVTD------------MKETRDAIVSASDLPLSIIIVGVGDADFDMMRELDGDDPKLRSPGRIAERDNVQ  481 (529)
T ss_pred             eEEEEEEeCCcccc------------HHHHHHHHHhhccCCeEEEEEEeCCCCHHHHHHhhcCCcccccccccccccceE
Confidence            99999999999998            9999999999999999999999999999999999998766       8999999


Q ss_pred             eeecccccccccccchHHHHHHHHHHhcCChHHHhhhcccccC
Q 013900          301 FVNFTKIMSENKETSKKEAAFALAALMEIPLQYKATLSLHSVN  343 (434)
Q Consensus       301 FV~f~~~~~~~~~~~~~~~~la~~~L~EiP~Q~~~~~~lg~l~  343 (434)
                      ||+|+||++++...+.++++||+.||||||+||++||+++-+.
T Consensus       482 FV~f~~~~~~~~~~~~~~~~lA~~vL~EIP~Q~~~y~~~~~~~  524 (529)
T KOG1327|consen  482 FVPFRDIMNGAENPSDKEAALALAVLAEIPQQYVQYMRLRGIL  524 (529)
T ss_pred             eecHHHHhhcCCcccchhHHHHHHHHHHhhHHHHHHHHhcCCC
Confidence            9999999998777778899999999999999999999995554

>cd01459 vWA_copine_like VWA Copine: Copines are phospholipid-binding proteins originally identified in paramecium	Back alignment and domain information

>PF07002 Copine: Copine; InterPro: IPR010734 This represents a conserved region approximately 180 residues long within eukaryotic copines	Back alignment and domain information

>PF10138 vWA-TerF-like: vWA found in TerF C terminus ; InterPro: IPR019303 This entry represents the N-terminal domain of a family of proteins that confer resistance to the metalloid element tellurium and its salts	Back alignment and domain information

>cd01457 vWA_ORF176_type VWA ORF176 type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>smart00327 VWA von Willebrand factor (vWF) type A domain	Back alignment and domain information

>KOG0320 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A	Back alignment and domain information

>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional	Back alignment and domain information

>KOG0823 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01461 vWA_interalpha_trypsin_inhibitor vWA_interalpha trypsin inhibitor (ITI): ITI is a glycoprotein composed of three polypeptides- two heavy chains and one light chain (bikunin)	Back alignment and domain information

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A	Back alignment and domain information

>KOG0317 consensus Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd00198 vWFA Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01463 vWA_VGCC_like VWA Voltage gated Calcium channel like: Voltage-gated calcium channels are a complex of five proteins: alpha 1, beta 1, gamma, alpha 2 and delta	Back alignment and domain information

>KOG4172 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01471 vWA_micronemal_protein Micronemal proteins: The Toxoplasma lytic cycle begins when the parasite actively invades a target cell	Back alignment and domain information

>PHA02929 N1R/p28-like protein; Provisional	Back alignment and domain information

>cd01450 vWFA_subfamily_ECM Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01464 vWA_subfamily VWA subfamily: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>KOG4275 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13519 VWA_2: von Willebrand factor type A domain; PDB: 3IBS_B 3RAG_B 2X5N_A	Back alignment and domain information

>cd01466 vWA_C3HC4_type VWA C3HC4-type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01465 vWA_subgroup VWA subgroup: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A	Back alignment and domain information

>TIGR00599 rad18 DNA repair protein rad18	Back alignment and domain information

>smart00504 Ubox Modified RING finger domain	Back alignment and domain information

>PHA02926 zinc finger-like protein; Provisional	Back alignment and domain information

>cd01454 vWA_norD_type norD type: Denitrifying bacteria contain both membrane bound and periplasmic nitrate reductases	Back alignment and domain information

>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A	Back alignment and domain information

>KOG4265 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01482 vWA_collagen_alphaI-XII-like Collagen: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions	Back alignment and domain information

>PF14634 zf-RING_5: zinc-RING finger domain	Back alignment and domain information

>cd01456 vWA_ywmD_type VWA ywmD type:Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01476 VWA_integrin_invertebrates VWA_integrin (invertebrates): Integrins are a family of cell surface receptors that have diverse functions in cell-cell and cell-extracellular matrix interactions	Back alignment and domain information

>KOG2177 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01473 vWA_CTRP CTRP for CS protein-TRAP-related protein: Adhesion of Plasmodium to host cells is an important phenomenon in parasite invasion and in malaria associated pathology	Back alignment and domain information

>cd01472 vWA_collagen von Willebrand factor (vWF) type A domain; equivalent to the I-domain of integrins	Back alignment and domain information

>cd01467 vWA_BatA_type VWA BatA type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03788 marine_srt_targ marine proteobacterial sortase target protein	Back alignment and domain information

>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)

Back alignment and domain information

>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>KOG0978 consensus E3 ubiquitin ligase involved in syntaxin degradation [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF13768 VWA_3: von Willebrand factor type A domain	Back alignment and domain information

>cd01470 vWA_complement_factors Complement factors B and C2 are two critical proteases for complement activation	Back alignment and domain information

>KOG0287 consensus Postreplication repair protein RAD18 [Replication, recombination and repair]	Back alignment and domain information

>KOG1571 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms]	Back alignment and domain information

>smart00184 RING Ring finger	Back alignment and domain information

>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B	Back alignment and domain information

>KOG0311 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01480 vWA_collagen_alpha_1-VI-type VWA_collagen alpha(VI) type: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions	Back alignment and domain information

>PTZ00441 sporozoite surface protein 2 (SSP2); Provisional	Back alignment and domain information

>PF00092 VWA: von Willebrand factor type A domain; InterPro: IPR002035 The von Willebrand factor is a large multimeric glycoprotein found in blood plasma	Back alignment and domain information

>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity	Back alignment and domain information

>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A	Back alignment and domain information

>cd01462 VWA_YIEM_type VWA YIEM type: Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01474 vWA_ATR ATR (Anthrax Toxin Receptor): Anthrax toxin is a key virulence factor for Bacillus anthracis, the causative agent of anthrax	Back alignment and domain information

>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis	Back alignment and domain information

>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>cd01453 vWA_transcription_factor_IIH_type Transcription factors IIH type: TFIIH is a multiprotein complex that is one of the five general transcription factors that binds RNA polymerase II holoenzyme	Back alignment and domain information

>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1785 consensus Tyrosine kinase negative regulator CBL [Defense mechanisms]	Back alignment and domain information

>cd01469 vWA_integrins_alpha_subunit Integrins are a class of adhesion receptors that link the extracellular matrix to the cytoskeleton and cooperate with growth factor receptors to promote celll survival, cell cycle progression and cell migration	Back alignment and domain information

>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only]	Back alignment and domain information

>cd01460 vWA_midasin VWA_Midasin: Midasin is a member of the AAA ATPase family	Back alignment and domain information

>cd01477 vWA_F09G8-8_type VWA F09G8	Back alignment and domain information

>cd01451 vWA_Magnesium_chelatase Magnesium chelatase: Mg-chelatase catalyses the insertion of Mg into protoporphyrin IX (Proto)	Back alignment and domain information

>cd01481 vWA_collagen_alpha3-VI-like VWA_collagen alpha 3(VI) like: The extracellular matrix represents a complex alloy of variable members of diverse protein families defining structural integrity and various physiological functions	Back alignment and domain information

>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule	Back alignment and domain information

>PRK13685 hypothetical protein; Provisional	Back alignment and domain information

>PF09967 DUF2201: VWA-like domain (DUF2201); InterPro: IPR018698 This family of various hypothetical bacterial proteins has no known function	Back alignment and domain information

>cd01455 vWA_F11C1-5a_type Von Willebrand factor type A (vWA) domain was originally found in the blood coagulation protein von Willebrand factor (vWF)	Back alignment and domain information

>cd01452 VWA_26S_proteasome_subunit 26S proteasome plays a major role in eukaryotic protein breakdown, especially for ubiquitin-tagged proteins	Back alignment and domain information

>cd01458 vWA_ku Ku70/Ku80 N-terminal domain	Back alignment and domain information

>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2879 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13406 bchD magnesium chelatase subunit D; Provisional	Back alignment and domain information

>KOG1100 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0802 consensus E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG4159 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR03436 acidobact_VWFA VWFA-related Acidobacterial domain	Back alignment and domain information

>TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D	Back alignment and domain information

>PF14447 Prok-RING_4: Prokaryotic RING finger family 4	Back alignment and domain information

>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger	Back alignment and domain information

>KOG1039 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02442 Cob-chelat-sub cobaltochelatase subunit	Back alignment and domain information

>KOG0826 consensus Predicted E3 ubiquitin ligase involved in peroxisome organization [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]	Back alignment and domain information

>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG0297 consensus TNF receptor-associated factor [Signal transduction mechanisms]	Back alignment and domain information

>KOG2660 consensus Locus-specific chromosome binding proteins [Function unknown]	Back alignment and domain information

>PRK10997 yieM hypothetical protein; Provisional	Back alignment and domain information

>KOG1813 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0825 consensus PHD Zn-finger protein [General function prediction only]	Back alignment and domain information

>KOG0828 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>KOG4692 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF04641 Rtf2: Rtf2 RING-finger	Back alignment and domain information

>PF05762 VWA_CoxE: VWA domain containing CoxE-like protein; InterPro: IPR008912 This group of proteins contains a VWA type domain and the function of this family is unknown	Back alignment and domain information

>KOG3002 consensus Zn finger protein [General function prediction only]	Back alignment and domain information

>KOG1002 consensus Nucleotide excision repair protein RAD16 [Replication, recombination and repair]	Back alignment and domain information

>TIGR00868 hCaCC calcium-activated chloride channel protein 1	Back alignment and domain information

>COG5175 MOT2 Transcriptional repressor [Transcription]	Back alignment and domain information

>KOG3039 consensus Uncharacterized conserved protein [Function unknown]	Back alignment and domain information

>KOG1734 consensus Predicted RING-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B	Back alignment and domain information

>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C	Back alignment and domain information

>KOG1001 consensus Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG2932 consensus E3 ubiquitin ligase involved in ubiquitination of E-cadherin complex [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1	Back alignment and domain information

>KOG1493 consensus Anaphase-promoting complex (APC), subunit 11 [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A	Back alignment and domain information

>COG1240 ChlD Mg-chelatase subunit ChlD [Coenzyme metabolism]	Back alignment and domain information

>COG2425 Uncharacterized protein containing a von Willebrand factor type A (vWA) domain [General function prediction only]	Back alignment and domain information

>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]	Back alignment and domain information

>COG4245 TerY Uncharacterized protein encoded in toxicity protection region of plasmid R478, contains von Willebrand factor (vWF) domain [General function prediction only]	Back alignment and domain information

>KOG4445 consensus Uncharacterized conserved protein, contains RWD domain [Function unknown]	Back alignment and domain information

>KOG1814 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG2114 consensus Vacuolar assembly/sorting protein PEP5/VPS11 [Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		434
4auq_B		62	Structure Of Birc7-Ubch5b-Ub Complex. Length = 62		1e-05
3eb5_A		74	Structure Of The Ciap2 Ring Domain Length = 74		5e-04
4ic2_A		74	Crystal Structure Of The Xiap Ring Domain Length =		7e-04
2ecg_A		75	Solution Structure Of The Ring Domain Of The Baculo		7e-04

>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62

Back alignment and structure

Iteration: 1
 Score = 47.8 bits (112), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 26/48 (54%), Gaps = 1/48 (2%)
Query: 387 EPVCPICLTNPKDMAF-GCGHTTCKDCGTTISSCPMCREPITTRLRLY 433
           E  C +CL     + F  CGH  C +C   +  CP+CR P+ +R+R +
Sbjct: 13  ERTCKVCLDRAVSIVFVPCGHLVCAECAPGLQLCPICRAPVRSRVRTF 60

PyMOL of 4auq

>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74

Back alignment and structure

>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74

Back alignment and structure

>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75

Back alignment and structure

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		434
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	4e-16
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	2e-15
2ea5_A		68	Cell growth regulator with ring finger domain prot	3e-14
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	5e-12
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	5e-12
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	8e-11
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	7e-08
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	7e-08
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	1e-07
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	2e-07
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	2e-07
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	2e-07
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	2e-07
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	3e-07
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	3e-07
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	3e-07
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	8e-07
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	8e-07
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	1e-06
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	1e-06
4epo_C		149	E3 ubiquitin-protein ligase RNF8; coiled-coil, E3	1e-06
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	1e-06
1z6u_A		150	NP95-like ring finger protein isoform B; structura	2e-06
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	2e-06
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	2e-06
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	3e-06
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	3e-06
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	3e-06
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	4e-06
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	4e-06
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	5e-06
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	5e-06
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	8e-06
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	1e-05
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	1e-05
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	2e-05
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	2e-05
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	4e-05
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	6e-05
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	6e-05
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	7e-05
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	1e-04
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	1e-04
3k1f_M		197	Transcription initiation factor IIB; RNA polymeras	2e-04
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	6e-04

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79	Back alignment and structure

 Score = 72.1 bits (177), Expect = 4e-16
 Identities = 14/49 (28%), Positives = 22/49 (44%), Gaps = 2/49 (4%)

Query: 387 EPVCPICLTNPKDMAFG-CGH-TTCKDCGTTISSCPMCREPITTRLRLY 433
             +C +C     +  F  CGH   C+ C   + SCP+CR  +     +Y
Sbjct: 18  AMLCMVCCEEEINSTFCPCGHTVCCESCAAQLQSCPVCRSRVEHVQHVY 66

PyMOL of 2yho

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75	Back alignment and structure

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Length = 78	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141	Back alignment and structure

>3k1f_M Transcription initiation factor IIB; RNA polymerase II, TFIIB, transcription factor, DNA-binding, DNA-directed RNA polymerase; 4.30A {Saccharomyces cerevisiae} Length = 197	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		434
2ea5_A		68	Cell growth regulator with ring finger domain prot	99.05
4ic3_A		74	E3 ubiquitin-protein ligase XIAP; ring domain, zin	99.0
2ecg_A		75	Baculoviral IAP repeat-containing protein 4; BIRC4	98.92
2yho_A		79	E3 ubiquitin-protein ligase mylip; ligase, E2 liga	98.86
2d8t_A		71	Dactylidin, ring finger protein 146; RNF146, ring	98.83
2ysl_A		73	Tripartite motif-containing protein 31; ring-type	98.82
2djb_A		72	Polycomb group ring finger protein 6; PCGF6, ring	98.78
2ea6_A		69	Ring finger protein 4; RNF4, RES4-26, ring domain,	98.77
2egp_A		79	Tripartite motif-containing protein 34; ZF-C3HC4 d	98.75
2yur_A		74	Retinoblastoma-binding protein 6; P53-associated c	98.73
1e4u_A		78	Transcriptional repressor NOT4; gene regulation, t	98.72
2ecw_A		85	Tripartite motif-containing protein 30; metal bind	98.72
2ecy_A		66	TNF receptor-associated factor 3; metal binding pr	98.72
2csy_A		81	Zinc finger protein 183-like 1; ring finger protei	98.71
2vje_B		63	MDM4 protein; proto-oncogene, phosphorylation, alt	98.71
2vje_A		64	E3 ubiquitin-protein ligase MDM2; proto-oncogene,	98.7
2ecn_A		70	Ring finger protein 141; RNF141, ring domain, zinc	98.7
2ecv_A		85	Tripartite motif-containing protein 5; metal bindi	98.68
1bor_A		56	Transcription factor PML; proto-oncogene, nuclear	98.68
3ztg_A		92	E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR	98.67
4ayc_A		138	E3 ubiquitin-protein ligase RNF8; DNA damage, K63	98.67
3l11_A		115	E3 ubiquitin-protein ligase RNF168; E3 ligase, rin	98.66
2ect_A		78	Ring finger protein 126; metal binding protein, st	98.66
3t6p_A		345	Baculoviral IAP repeat-containing protein 2; ring,	98.65
1t1h_A		78	Gspef-atpub14, armadillo repeat containing protein	98.64
3ng2_A		71	RNF4, snurf, ring finger protein 4; ring domain, E	98.63
1chc_A		68	Equine herpes virus-1 ring domain; viral protein;	98.61
3fl2_A		124	E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA	98.57
2ep4_A		74	Ring finger protein 24; zinc binding, ubiquitin, E	98.56
3lrq_A		100	E3 ubiquitin-protein ligase TRIM37; structural gen	98.54
2kiz_A		69	E3 ubiquitin-protein ligase arkadia; ring-H2 finge	98.54
2ecj_A		58	Tripartite motif-containing protein 39; TRIM39, ri	98.54
2ct2_A		88	Tripartite motif protein 32; zinc-finger protein H	98.53
2xeu_A		64	Ring finger protein 4; transcription, zinc-finger,	98.52
2ysj_A		63	Tripartite motif-containing protein 31; ring-type	98.51
2ckl_A		108	Polycomb group ring finger protein 4; BMI1, RING1B	98.48
1wgm_A		98	Ubiquitin conjugation factor E4A; ubiquitinating e	98.48
1g25_A		65	CDK-activating kinase assembly factor MAT1; ring f	98.48
1iym_A		55	EL5; ring-H2 finger, ubiquitin ligase, DNA binding	98.47
1jm7_B		117	BARD1, BRCA1-associated ring domain protein 1; rin	98.46
2kr4_A		85	Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri	98.46
1z6u_A		150	NP95-like ring finger protein isoform B; structura	98.45
2l0b_A		91	E3 ubiquitin-protein ligase praja-1; zinc finger,	98.44
1jm7_A		112	BRCA1, breast cancer type 1 susceptibility protein	98.43
2y43_A		99	E3 ubiquitin-protein ligase RAD18; DNA repair, met	98.42
2kre_A		100	Ubiquitin conjugation factor E4 B; U-box domain, E	98.42
1x4j_A		75	Ring finger protein 38; structural genomics, NPPSF	98.41
2ecm_A		55	Ring finger and CHY zinc finger domain- containing	98.39
3hct_A		118	TNF receptor-associated factor 6; cross-brace, bet	98.38
2ckl_B		165	Ubiquitin ligase protein RING2; BMI1, RING1B, poly	98.38
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	98.36
1v87_A		114	Deltex protein 2; ring-H2 domain, zinc-binding dom	98.31
2y1n_A		389	E3 ubiquitin-protein ligase; ligase-transferase co	98.27
3knv_A		141	TNF receptor-associated factor 2; cross-brace, alt	98.26
1rmd_A		116	RAG1; V(D)J recombination, antibody, MAD, ring fin	98.26
4hqf_A		281	Thrombospondin-related anonymous protein, trap; ma	98.2
4hqo_A		266	Sporozoite surface protein 2; malaria, gliding mot	98.16
2yu4_A		94	E3 SUMO-protein ligase NSE2; SP-ring domain, struc	98.15
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.13
2f42_A		179	STIP1 homology and U-box containing protein 1; cha	98.1
3hcs_A		170	TNF receptor-associated factor 6; cross-brace, bet	98.07
4ap4_A		133	E3 ubiquitin ligase RNF4; ligase-signalling protei	98.02
2ecl_A		81	Ring-box protein 2; RNF7, ring domian, zinc-bindin	97.99
1shu_X		182	Anthrax toxin receptor 2; alpha/beta rossmann fold	97.95
3n2n_F		185	Anthrax toxin receptor 1; rossmann fold; 1.80A {Ho	97.91
3ibs_A		218	Conserved hypothetical protein BATB; structural ge	97.85
3htk_C		267	E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-	97.82
2xgg_A		178	Microneme protein 2; A/I domain, cell adhesion, hy	97.76
4fx5_A		464	VON willebrand factor type A; structural genomics,	97.74
1q0p_A		223	Complement factor B; VON willebrand factor, MAC-1,	97.73
2d8s_A		80	Cellular modulator of immune recognition; C-MIR, m	97.72
3dpl_R		106	Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST	97.67
4b4t_W		268	RPN10, 26S proteasome regulatory subunit RPN10; hy	97.6
2b2x_A		223	Integrin alpha-1; computational design, antibody-a	97.59
1n3y_A		198	Integrin alpha-X; alpha/beta rossmann fold, cell a	97.58
1pt6_A		213	Integrin alpha-1; cell adhesion; 1.87A {Homo sapie	97.57
1atz_A		189	VON willebrand factor; collagen-binding, hemostasi	97.57
1wim_A		94	KIAA0161 protein; ring finger domain, UBCM4-intera	97.56
1ijb_A		202	VON willebrand factor; dinucleotide-binding fold,	97.56
4a0k_B		117	E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi	97.51
2odp_A		509	Complement C2; C3/C5 convertase, complement serin	97.45
2x5n_A		192	SPRPN10, 26S proteasome regulatory subunit RPN10;	97.42
1v7p_C		200	Integrin alpha-2; snake venom, C-type lectin, anta	97.36
2x31_A		189	Magnesium-chelatase 60 kDa subunit; ligase, bacter	97.28
1mf7_A		194	Integrin alpha M; cell adhesion; 1.25A {Homo sapie	97.27
2bay_A		61	PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l	97.23
1rrk_A		497	Complement factor B; BB, hydrolase; 2.00A {Homo sa	97.15
3hrz_D		741	Complement factor B; serine protease, glycosilated	96.99
3vk6_A		101	E3 ubiquitin-protein ligase hakai; HYB, phosphotyr	96.79
3zqk_A		199	VON willebrand factor; blood clotting, adamts-13,	96.57
2ct0_A		74	Non-SMC element 1 homolog; ring domain, structural	96.25
1jey_A		609	KU70; double-strand DNA break repair, non-homologo	96.2
3k6s_A		1095	Integrin alpha-X; cell receptor, adhesion molecule	96.02
1mjn_A		179	Integrin alpha-L; rossmann fold, immune system; 1.	95.8
3k1l_B		381	Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A	95.68
1jey_B		565	KU80; double-strand DNA break repair, non-homologo	95.35
1vyx_A		60	ORF K3, K3RING; zinc-binding protein, ring domain,	95.17
1yvr_A		538	RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein,	94.38
2ko5_A		99	Ring finger protein Z; lassa fever virus-Z, negati	93.11
2nvo_A		535	RO sixty-related protein, RSR; alpha helical repea	92.97
2jun_A		101	Midline-1; B-BOX, TRIM, ring finger, alternative s	89.85

>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

Probab=99.05  E-value=1.2e-10  Score=91.02  Aligned_cols=53  Identities=25%  Similarity=0.622  Sum_probs=47.2

Q ss_pred             cccCCCCccCccccCCcc-ceecCCCC-CchhhhcCCCCCCCcCcccccccccCC
Q 013900          382 ATALVEPVCPICLTNPKD-MAFGCGHT-TCKDCGTTISSCPMCREPITTRLRLYT  434 (434)
Q Consensus       382 p~~~e~~~CpICl~~~kd-v~l~CGH~-fC~~Ci~~l~~CPlCR~~i~~~i~ly~  434 (434)
                      +...+...|+||++.+++ +.++|||. ||..|+.....||+||.+|..++++|.
T Consensus        10 ~~~~~~~~C~IC~~~~~~~v~~pCgH~~~C~~C~~~~~~CP~CR~~i~~~~~i~~   64 (68)
T 2ea5_A           10 PSEENSKDCVVCQNGTVNWVLLPCRHTCLCDGCVKYFQQCPMCRQFVQESFALSG   64 (68)
T ss_dssp             CSCCCSSCCSSSSSSCCCCEETTTTBCCSCTTHHHHCSSCTTTCCCCCCEECCCS
T ss_pred             ccCCCCCCCCCcCcCCCCEEEECCCChhhhHHHHhcCCCCCCCCcchhceEEeec
Confidence            344567899999999999 56699999 999999999999999999999999984

PyMOL of 2ea5

>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A	Back alignment and structure

>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A	Back alignment and structure

>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens}	Back alignment and structure

>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens}	Back alignment and structure

>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B	Back alignment and structure

>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus}	Back alignment and structure

>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B*	Back alignment and structure

>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A	Back alignment and structure

>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens}	Back alignment and structure

>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C	Back alignment and structure

>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens}	Back alignment and structure

>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus}	Back alignment and structure

>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B	Back alignment and structure

>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2	Back alignment and structure

>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus}	Back alignment and structure

>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1	Back alignment and structure

>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens}	Back alignment and structure

>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens}	Back alignment and structure

>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens}	Back alignment and structure

>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens}	Back alignment and structure

>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A	Back alignment and structure

>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2	Back alignment and structure

>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1	Back alignment and structure

>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus}	Back alignment and structure

>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens}	Back alignment and structure

>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens}	Back alignment and structure

>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens}	Back alignment and structure

>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B	Back alignment and structure

>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A	Back alignment and structure

>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A	Back alignment and structure

>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1	Back alignment and structure

>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A*	Back alignment and structure

>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens}	Back alignment and structure

>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1	Back alignment and structure

>4hqf_A Thrombospondin-related anonymous protein, trap; malaria, parasite motility, I domain, TSR domain, receptor O sporozoite, vaccine target; 2.20A {Plasmodium falciparum} PDB: 4hqk_A 2bbx_A	Back alignment and structure

>4hqo_A Sporozoite surface protein 2; malaria, gliding motility, VWA domain, TSR domain, extensibl ribbon, receptor on sporozoite, vaccine target; HET: FUC BGC; 2.19A {Plasmodium vivax} PDB: 4hql_A* 4hqn_A*	Back alignment and structure

>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C	Back alignment and structure

>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens}	Back alignment and structure

>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus}	Back alignment and structure

>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1shu_X Anthrax toxin receptor 2; alpha/beta rossmann fold, membrane protein; 1.50A {Homo sapiens} SCOP: c.62.1.1 PDB: 1tzn_a 1sht_X 1t6b_Y*	Back alignment and structure

>3n2n_F Anthrax toxin receptor 1; rossmann fold; 1.80A {Homo sapiens} SCOP: c.62.1.1	Back alignment and structure

>3ibs_A Conserved hypothetical protein BATB; structural genomics, protein structure, midwest center for S genomics, MCSG, PSI-2; HET: MSE; 2.10A {Bacteroides thetaiotaomicron}	Back alignment and structure

>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae}	Back alignment and structure

>2xgg_A Microneme protein 2; A/I domain, cell adhesion, hydrolase; 2.05A {Toxoplasma gondii}	Back alignment and structure

>4fx5_A VON willebrand factor type A; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, blood clotting; HET: MSE; 1.73A {Catenulispora acidiphila}	Back alignment and structure

>1q0p_A Complement factor B; VON willebrand factor, MAC-1, I domain, A domain, hydrolase; 1.80A {Homo sapiens} SCOP: c.62.1.1	Back alignment and structure

>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A	Back alignment and structure

>4b4t_W RPN10, 26S proteasome regulatory subunit RPN10; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>2b2x_A Integrin alpha-1; computational design, antibody-antigen complex, immune syste; 2.20A {Rattus norvegicus} SCOP: c.62.1.1	Back alignment and structure

>1n3y_A Integrin alpha-X; alpha/beta rossmann fold, cell adhesion; 1.65A {Homo sapiens} SCOP: c.62.1.1	Back alignment and structure

>1pt6_A Integrin alpha-1; cell adhesion; 1.87A {Homo sapiens} SCOP: c.62.1.1 PDB: 4a0q_A 1qcy_A 1qc5_A 1qc5_B 1ck4_A 1mhp_A	Back alignment and structure

>1atz_A VON willebrand factor; collagen-binding, hemostasis, dinucleotide binding fold; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 4dmu_B 2adf_A 1fe8_A 1ao3_A	Back alignment and structure

>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1	Back alignment and structure

>1ijb_A VON willebrand factor; dinucleotide-binding fold, blood clotting; 1.80A {Homo sapiens} SCOP: c.62.1.1 PDB: 1ijk_A 1auq_A 1u0n_A 3hxo_A 1uex_C 3hxq_A 1sq0_A 1m10_A 1fns_A 1oak_A 1u0o_C	Back alignment and structure

>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus}	Back alignment and structure

>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A*	Back alignment and structure

>2x5n_A SPRPN10, 26S proteasome regulatory subunit RPN10; nuclear protein, nucleus, ubiquitin; 1.30A {Schizosaccharomyces pombe}	Back alignment and structure

>1v7p_C Integrin alpha-2; snake venom, C-type lectin, antagonist, cell adhes glycoprotein, toxin-cell adhesion complex; HET: NAG; 1.90A {Homo sapiens} SCOP: c.62.1.1 PDB: 1aox_A 1dzi_A	Back alignment and structure

>2x31_A Magnesium-chelatase 60 kDa subunit; ligase, bacteriochlorophyll biosynthesis, photosynthesis; 7.50A {Rhodobacter capsulatus}	Back alignment and structure

>1mf7_A Integrin alpha M; cell adhesion; 1.25A {Homo sapiens} SCOP: c.62.1.1 PDB: 1na5_A 1jlm_A 1ido_A 1m1u_A 3q3g_G 1n9z_A 1bhq_1 1bho_1 1idn_1 3qa3_G	Back alignment and structure

>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A	Back alignment and structure

>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A	Back alignment and structure

>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F*	Back alignment and structure

>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus}	Back alignment and structure

>3zqk_A VON willebrand factor; blood clotting, adamts-13, force sensor, VON willebrand DISE domain, haemostasis; HET: NAG; 1.70A {Homo sapiens} PDB: 3ppv_A 3ppx_A 3ppw_A 3ppy_A 3gxb_A*	Back alignment and structure

>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens}	Back alignment and structure

>1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B	Back alignment and structure

>3k6s_A Integrin alpha-X; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_A* 3k72_A*	Back alignment and structure

>1mjn_A Integrin alpha-L; rossmann fold, immune system; 1.30A {Homo sapiens} SCOP: c.62.1.1 PDB: 3hi6_A 1mq8_B* 3eoa_I 3eob_I 1rd4_A* 1lfa_A 1zon_A 1zoo_A 1zop_A 1dgq_A 1xdd_A* 1xdg_A* 1xuo_A* 3e2m_A* 3bqn_B* 1cqp_A* 3bqm_B* 2ica_A* 2o7n_A* 3m6f_A* ...	Back alignment and structure

>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster}	Back alignment and structure

>1jey_B KU80; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.2 c.62.1.4 PDB: 1jeq_B*	Back alignment and structure

>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3	Back alignment and structure

>1yvr_A RO autoantigen, 60-kDa SS-A/RO ribonucleoprotein, 60 kDa; heat repeat, VON willebrand factor A, rossmann fold, midas motif', RNA binding protein; 1.95A {Xenopus laevis} SCOP: a.118.25.1 c.62.1.5 PDB: 1yvp_A 2i91_A	Back alignment and structure

>2nvo_A RO sixty-related protein, RSR; alpha helical repeats, VON willebrand factor A domain, beta- RNA binding protein; 1.89A {Deinococcus radiodurans}	Back alignment and structure

>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		434
d1fbva4		79	g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta	2e-09
d1chca_		68	g.44.1.1 (A:) Immediate early protein, IEEHV {Equi	2e-08
d1bora_		56	g.44.1.1 (A:) Acute promyelocytic leukaemia proto-	3e-08
d1rmda2		86	g.44.1.1 (A:1-86) V(D)J recombination activating p	3e-08
d1jm7a_		103	g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie	5e-07
d2baya1		56	g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {	1e-06
d1g25a_		65	g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi	3e-06
d1vyxa_		60	g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do	5e-06
d1iyma_		55	g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati	5e-05
d1ur6b_		52	g.44.1.1 (B:) Not-4 N-terminal RING finger domain	2e-04
d1jm7b_		97	g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie	2e-04

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79	Back information, alignment and structure


class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: CBL
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 51.9 bits (124), Expect = 2e-09
 Identities = 17/51 (33%), Positives = 21/51 (41%), Gaps = 6/51 (11%)

Query: 389 VCPICLTNPKDMAF-GCGHTTCKDCGTTI-----SSCPMCREPITTRLRLY 433
           +C IC  N KD+    CGH  C  C T+        CP CR  I     + 
Sbjct: 25  LCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIV 75

PyMOL of d1fbva4

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68	Back information, alignment and structure

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97	Back information, alignment and structure

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		434
d1bora_		56	Acute promyelocytic leukaemia proto-oncoprotein PM	98.78
d1fbva4		79	CBL {Human (Homo sapiens) [TaxId: 9606]}	98.76
d1rmda2		86	V(D)J recombination activating protein 1 (RAG1), d	98.66
d1t1ha_		78	E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi	98.64
d1chca_		68	Immediate early protein, IEEHV {Equine herpesvirus	98.64
d1jm7a_		103	brca1 RING domain {Human (Homo sapiens) [TaxId: 96	98.6
d2c2la2		80	STIP1 homology and U box-containing protein 1, STU	98.56
d1jm7b_		97	bard1 RING domain {Human (Homo sapiens) [TaxId: 96	98.54
d1g25a_		65	TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9	98.52
d1iyma_		55	EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45	98.49
d1ur6b_		52	Not-4 N-terminal RING finger domain {Human (Homo s	98.42
d2baya1		56	Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac	98.41
d1shux_		181	Capillary morphogenesis protein 2 domain {Human (H	98.15
d1v87a_		114	Deltex protein 2 RING-H2 domain {Mouse (Mus muscul	98.04
d1wgma_		98	Ubiquitin conjugation factor E4A {Human (Homo sapi	97.95
d1vyxa_		60	IE1B protein (ORF K3), N-terminal domain {Kaposi's	97.7
d3dplr1		88	RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase	97.7
d1jeya2		220	Ku70 subunit N-terminal domain {Human (Homo sapien	97.32
d1q0pa_		209	Complement factor B domain {Human (Homo sapiens) [	97.29
d1v7pc_		193	Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId	97.27
d1atza_		184	von Willebrand factor A3 domain, vWA3 {Human (Homo	97.18
d1mf7a_		194	Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha sub	96.98
d1pt6a_		192	Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId	96.88
d1wima_		94	UbcM4-interacting protein 4 (KIAA0161) {Human (Hom	96.76
d1ijba_		202	von Willebrand factor A1 domain, vWA1 {Human (Homo	96.66
d1n3ya_		189	Integrin alpha-x beta2 {Human (Homo sapiens) [TaxI	96.49
d1jeyb2		236	Ku80 subunit N-terminal domain {Human (Homo sapien	96.09
d1yvra2		174	60-kda SS-A/Ro ribonucleoprotein, RoRNP {African c	96.09
d1mjna_		179	Integrin CD11a/CD18 (Leukocyte function associated	95.18

>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Acute promyelocytic leukaemia proto-oncoprotein PML
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.78  E-value=1.3e-09  Score=80.57  Aligned_cols=44  Identities=27%  Similarity=0.591  Sum_probs=38.6

Q ss_pred             CCCccCccccCCcc-ceecCCCCCchhhhcCC-CCCCCcCcccccc
Q 013900          386 VEPVCPICLTNPKD-MAFGCGHTTCKDCGTTI-SSCPMCREPITTR  429 (434)
Q Consensus       386 e~~~CpICl~~~kd-v~l~CGH~fC~~Ci~~l-~~CPlCR~~i~~~  429 (434)
                      +.+.|+||++.+++ +.++|||.||..|+.++ ..||+||+++...
T Consensus         5 ~~l~C~IC~~~~~~p~~lpCgH~fC~~Ci~~~~~~CP~Cr~~~~~~   50 (56)
T d1bora_           5 QFLRCQQCQAEAKCPKLLPCLHTLCSGCLEASGMQCPICQAPWPLG   50 (56)
T ss_dssp             CCSSCSSSCSSCBCCSCSTTSCCSBTTTCSSSSSSCSSCCSSSSCC
T ss_pred             CCCCCcccCcccCCCEEecCCCHHhHHHHHcCCCcCcCCCCcccCC
Confidence            34699999999999 88899999999999877 5899999998654

PyMOL of d1bora_

>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]}	Back information, alignment and structure

>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1shux_ c.62.1.1 (X:) Capillary morphogenesis protein 2 domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]}	Back information, alignment and structure

>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jeya2 c.62.1.3 (A:34-253) Ku70 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1q0pa_ c.62.1.1 (A:) Complement factor B domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1v7pc_ c.62.1.1 (C:) Integrin alpha2-beta1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1atza_ c.62.1.1 (A:) von Willebrand factor A3 domain, vWA3 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1mf7a_ c.62.1.1 (A:) Integrin alpha M (CR3, CD11b/CD18, Mac-1 alpha subunit) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1pt6a_ c.62.1.1 (A:) Integrin alpha1-beta1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1n3ya_ c.62.1.1 (A:) Integrin alpha-x beta2 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1jeyb2 c.62.1.4 (B:6-241) Ku80 subunit N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1yvra2 c.62.1.5 (A:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}	Back information, alignment and structure

>d1mjna_ c.62.1.1 (A:) Integrin CD11a/CD18 (Leukocyte function associated antigen-1, LFA-1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure