Citrus Sinensis ID: 013964

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---

MAEKEESQNPTPPPPVTETEQPPSTATAVKEPAVTSQTEEQPPAAPAVENRSLAAMMEKEASAPEKTKEDVVVAADSVEKVDEKEKQPPPVQPEEPKIPQTLISFKEESNVIADLSDSERKALQELKQLVQEALNNRHFTSPKEEEKEKQPPPSSDAPKTDGPSSESDKSTEIKPPQEQQAPAEVAPPPPQPPAEEEVSIWGVPLLKDDRTDVILLKFLRARDFKVRDAFVMIKNTIQWRKDFGIEALLNEDLGDDLEKVVFMHGFDRDGHPVCYNVYGEFQNKQLYAKTFSDEEKRMKFLRWRIQFLERSIRKLNFRPGGVSTIFQVNDLKNSPGPGKRELRIATKQALQLLQDNYPEFVAKQVFINVPWWYLAFHTMISPFMTQRTKSKFVFAGPSKSTETLFKLVNIILSLPILYVVALLFGWLSSRFNY

cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccccHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccccccccccccccccEEEEEECccccccEEEEEcccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccccHccccEEEEcccccHHHHHHHcccccccHHHHHHHHccccccccccc

*****************************************************************************************************************************************************************************************************VSIWGVPLLKDDRTDVILLKFLRARDFKVRDAFVMIKNTIQWRKDFGIEALLNEDLGDDLEKVVFMHGFDRDGHPVCYNVYGEFQNKQLYAKTFSDEEKRMKFLRWRIQFLERSIRKLNFRPGGVSTIFQVNDLKNSPGPGKRELRIATKQALQLLQDNYPEFVAKQVFINVPWWYLAFHTMISPFMTQRTKSKFVFAGPSKSTETLFKLVNIILSLPILYVVALLFGWLSS**NY

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MAEKEESQNPTPPPPVTETEQPPSTATAVKEPAVTSQTEEQPPAAPAVENRSLAAMMEKEASAPEKTKEDVVVAADSVEKVDEKEKQPPPVQPEEPKIPQTLISFKEESNVxxxxxxxxxxxxxxxxxxxxxxxxxRHFTSPKEEEKEKQPPPSSDAPKTDGPSSESDKSTEIKPPQEQQAPAEVAPPPPQPPAEEEVSIWGVPLLKDDRTDVILLKFLRARDFKVRDAFVMIKNTIQWRKDFGIEALLNEDLGDDLEKVVFMHGFDRDGHPVCYNVYGEFQNKQLYAKTFSDEEKRMKFLRWRIQFLERSIRKLNFRPGGVSTIFQVNDLKNSPGPGKRELRIATKQALQLLQDNYPEFVAKQVFINVPWWYLAFHTMISPFMTQRTKSKFVFAGPSKSTETLFKLVNIILSLPILYVVALLFGWLSSRFNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Patellin-3	Carrier protein that may be involved in membrane-trafficking events associated with cell plate formation during cytokinesis. Binds to some hydrophobic molecules such as phosphoinositides and promotes their transfer between the different cellular sites.	probable	Q56Z59

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1AUA, chain A
Confidence level:very confident
Coverage over the Query: 104-134,206-426
View the alignment between query and template
View the model in PyMOL

Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 132-202
View the alignment between query and template
View the model in PyMOL