Citrus Sinensis ID: 013971


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430---
MSSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSDVTTNKSSDLTYRSRFLLHDSADSIGLSGLLVLPQAFGAIYLGETFCSYISINNSSTLEVRDVVIKAEIQTDKQRILLLDTSKSPVESIRAGGRYDFIVEHDVKELGAHTLVCTALYSDGEGERKYLPQFFKFIVSNPLSVRTKVRVVKEITFLEACIENHTKSNLYMDQVEFEPSQNWSATMLKADGPHSDYNAQSREIFKPPVLIRSGGGIHNYLYQLKMLSHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVGIDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHLNLIATKLGVQRITGITVFDKLEKITYDSLPDLE
cccccccccEEEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccEEEEEEEEEEEcccEEEEEcccccccccccccccCEEEEEEEEcEEcccEEEEEEEEEEcccccEEEEEEEEEEEccccCEEEEEEEEEcccEEEEEEEEEcccccEEEEEEEEECcccccEEEcccccccccccccccccccccCEEEccccEEEEEEEEECcccccccccccccccccEEEEEEEEcccccccEEEEEEEEccccccccEEEEEEEcccEEEEcccEEEEEEEEEccccccccEEEEEEccccccccEEEEccccEEECcccccccCEEEEEEEEEcccEEEEEccEEEEEccccCECccccccc
******T**LAFRVMRLCRPSLHVEPPLRVDPTDLFIGE**************************************SADSIGLSGLLVLPQAFGAIYLGETFCSYISINNSSTLEVRDVVIKAEIQTDKQRILLLDTSKSPVESIRAGGRYDFIVEHDVKELGAHTLVCTALYSDGEGERKYLPQFFKFIVSNPLSVRTKVRVVKEITFLEACIENHTKSNLYMDQVEFEPSQNWSATM***************EIFKPPVLIRSGGGIHNYLYQLKMLSH********QGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVGIDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHLNLIATKLGVQRITGITVFDKLEKITYDSLPD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTPGTHSLAFRVMRLCRPSLHVEPPLRVDPTDLFIGEDIFDDPIAASNLPPLISSDVTTNKSSDLTYRSRFLLHDSADSIGLSGLLVLPQAFGAIYLGETFCSYISINNSSTLEVRDVVIKAEIQTDKQRILLLDTSKSPVESIRAGGRYDFIVEHDVKELGAHTLVCTALYSDGEGERKYLPQFFKFIVSNPLSVRTKVRVVKEITFLEACIENHTKSNLYMDQVEFEPSQNWSATMLKADGPHSDYNAQSREIFKPPVLIRSGGGIHNYLYQLKMLSHGSSSPVKVQGSNVLGKLQITWRTNLGEPGRLQTQQILGTTITSKEIELNVVEVPSVVGIDKPFLLKLKLTNQTDKEQGPFEIWLSQNDSDEEKVVMINGLRIMALAPVEAFGSTDFHLNLIATKLGVQRITGITVFDKLEKITYDSLPDLE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UPF0533 protein C5orf44 homolog probableQ3TIR1
UPF0533 protein CG4953 probableQ95TN1
UPF0533 protein C5orf44 homolog probableA7MB76

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EX0, chain A
Confidence level:probable
Coverage over the Query: 155-413
View the alignment between query and template
View the model in PyMOL
Template: 2QSV, chain A
Confidence level:probable
Coverage over the Query: 93-229
View the alignment between query and template
View the model in PyMOL
Template: 3QBT, chain B
Confidence level:probable
Coverage over the Query: 339-426
View the alignment between query and template
View the model in PyMOL