Citrus Sinensis ID: 013976


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MSWRTSTTFRASRRFTSSSTASIKLIMAAAPSKDAIVTWIKKKIGPGIYNITTLDEAERVLTSETKVVLGYLNSLVGSESEVLADASRLEDDVNFYQTTNPDVAKIFHLDSKVNRPALVMVKKETEKISYFADGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLEGKLKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPTSEPKAESSDIKESHESSSDKDVKDEL
ccccccHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHHcccccEECccHHHHHHHHccccEEEEEEEccccccHHHHHHHHHccccccCEEECccHHHHHHccccccccccCEEEEccccccEEEcccccccHHHHHHHHHcccccEEEEEcccccccccccccEEEEEEEECcccHHHHHHHHHHHHHHHcccEEEEEEEccccccccccHHccccccccccEEEEccccccccccccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccEEEEECccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccc
*****STTFRASRRFTSSSTASIKLIMAAAPSKDAIVTWIKKKIGPGIYNITTLDEAERVLTSETKVVLGYLNSLVGSESEVLADASRLEDDVNFYQTTNPDVAKIFHLDSKVNRPALVMVKKETEKISYFADGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLEGKLKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPF****************************************L
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSWRTSTTFRASRRFTSSSTASIKLIMAAAPSKDAIVTWIKKKIGPGIYNITTLDEAERVLTSETKVVLGYLNSLVGSESEVLADASRLEDDVNFYQTTNPDVAKIFHLDSKVNRPALVMVKKETEKISYFADGKFDKSTIADFVFSNKLPLVTIFTRENAPSVFESPIKNQLLLFAVSNDSEKLLPVFEEAAKSFKGKLIFVYVQMDNEDVGKPVSEYFGITGEAPKVLAYTGNDDAKKHILDGELTLDKIKTFGEDFLEGKLKPFFKSDPIPETNDGDVKIVVGNNFDEIVLDESKDVLLEIYAPWCGHCQAFEPTYNKLAKHLRGVDSIVIAKMDGTTNEHHRAKSDGFPTILFFPAGNKSFDPINVDVDRTVVALYKFLKKNASIPFKIQKPTSAPKTEKPTSEPKAESSDIKESHESSSDKDVKDEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein disulfide isomerase-like 1-4 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds. May play a role in storage protein biogenesis.probableQ67IX6
Protein disulfide isomerase-like 1-4 Acts as a protein-folding catalyst that interacts with nascent polypeptides to catalyze the formation, isomerization, and reduction or oxidation of disulfide bonds.probableQ9FF55

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.3.-.-Intramolecular oxidoreductases.probable
5.3.4.-Transposing S-S bonds.probable
5.3.4.1Protein disulfide-isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3F8U, chain A
Confidence level:very confident
Coverage over the Query: 1-393
View the alignment between query and template
View the model in PyMOL