Citrus Sinensis ID: 014025
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 432 | ||||||
| 449459066 | 869 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.981 | 0.487 | 0.799 | 0.0 | |
| 255570825 | 876 | sumo ligase, putative [Ricinus communis] | 0.983 | 0.485 | 0.817 | 0.0 | |
| 357472339 | 882 | E3 SUMO-protein ligase SIZ1 [Medicago tr | 0.990 | 0.485 | 0.771 | 0.0 | |
| 225435251 | 876 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.986 | 0.486 | 0.787 | 0.0 | |
| 356550169 | 885 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.983 | 0.480 | 0.769 | 0.0 | |
| 356550167 | 880 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.983 | 0.482 | 0.769 | 0.0 | |
| 356543434 | 895 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.983 | 0.474 | 0.760 | 0.0 | |
| 356543432 | 882 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.983 | 0.481 | 0.760 | 0.0 | |
| 356539120 | 879 | PREDICTED: E3 SUMO-protein ligase SIZ1-l | 0.990 | 0.486 | 0.783 | 0.0 | |
| 297819032 | 873 | predicted protein [Arabidopsis lyrata su | 0.988 | 0.489 | 0.75 | 0.0 |
| >gi|449459066|ref|XP_004147267.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Cucumis sativus] gi|449511458|ref|XP_004163961.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 729 bits (1881), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 343/429 (79%), Positives = 392/429 (91%), Gaps = 5/429 (1%)
Query: 1 MDSVASCKEKLAHFRIKELKDVLTQLGLSKQGKKQDLVDRILAILSDDQVSKMWAKKSPV 60
MD VA+CK+KLA+FRIKELKD+LTQLGLSKQGKKQDLV RIL ILSD+QVSKMWAKK+ V
Sbjct: 1 MDLVANCKDKLAYFRIKELKDILTQLGLSKQGKKQDLVQRILDILSDEQVSKMWAKKNAV 60
Query: 61 SKEEVAKLVDDTHRKLQVSVAPDLASKGGQGVSNSSNIKIKGEMDDYIQSDTKVCCPCGS 120
K++VAKLVDDT+RK+QVS DLA+KG QGVS+SSN+++KGE DD +Q DTKV C CG+
Sbjct: 61 GKDQVAKLVDDTYRKMQVS-GVDLATKG-QGVSDSSNVQVKGETDDSLQLDTKVRCLCGN 118
Query: 121 SLETESMIKCEDPRCPVWQHMSCVIIPEKPTEGNPPVPELFYCEICRLSRADPFWVTIGH 180
L+TESMIKCEDPRC VWQH+SCVI+PEKPTEGNPP PE FYCEICRL+RADPFWV++ H
Sbjct: 119 GLQTESMIKCEDPRCQVWQHISCVIVPEKPTEGNPPYPEHFYCEICRLNRADPFWVSVAH 178
Query: 181 PLYPLKLTTT---NIPTDGTNPARILEKTFPITRADKDLLSKQEYDVQAWCMLLNDKVPF 237
PL+P+KL TT NIPTDGTNP + ++++F +TRADKDLLSKQEYDVQAWCMLLNDKVPF
Sbjct: 179 PLFPVKLITTMSTNIPTDGTNPMQSVDRSFQLTRADKDLLSKQEYDVQAWCMLLNDKVPF 238
Query: 238 RMQWPQYADLQVNGVPVRAINRPGSQLLGANGRDDGPIITPWTKDGINKIVLTGCDARIF 297
RMQWPQYADLQ+NG+ VRAINRPGSQLLGANGRDDGPIIT TKDG+NKI LTGCDAR F
Sbjct: 239 RMQWPQYADLQINGLAVRAINRPGSQLLGANGRDDGPIITACTKDGMNKIALTGCDARSF 298
Query: 298 CLGVRIVKRRSVQQVLNLIPKESEGEHFEDALTRVCRCVGGGNAADNADSDSDLEVVADS 357
CLGVRIVKRR+VQQ+L++IPKES+GE F+DAL R+CRC+GGGN ADNADSDSDLEVVA+
Sbjct: 299 CLGVRIVKRRTVQQILSMIPKESDGERFQDALARICRCIGGGNTADNADSDSDLEVVAEF 358
Query: 358 IGVNLRCPMSGSRIKVAGRFKPCVHMGCFDLDVFVELNQRSRKWQCPICLRNYSLENIII 417
GVNLRCPMSGSR+K+AGRFKPC HMGCFDL+VFVELNQRSRKWQCPICL+NY+LEN+II
Sbjct: 359 FGVNLRCPMSGSRMKIAGRFKPCAHMGCFDLEVFVELNQRSRKWQCPICLKNYALENVII 418
Query: 418 DPYFNRITS 426
DPYFNRITS
Sbjct: 419 DPYFNRITS 427
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255570825|ref|XP_002526365.1| sumo ligase, putative [Ricinus communis] gi|223534324|gb|EEF36036.1| sumo ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|357472339|ref|XP_003606454.1| E3 SUMO-protein ligase SIZ1 [Medicago truncatula] gi|355507509|gb|AES88651.1| E3 SUMO-protein ligase SIZ1 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|225435251|ref|XP_002284945.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356550169|ref|XP_003543461.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356550167|ref|XP_003543460.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356543434|ref|XP_003540165.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform 2 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356543432|ref|XP_003540164.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like isoform 1 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356539120|ref|XP_003538048.1| PREDICTED: E3 SUMO-protein ligase SIZ1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297819032|ref|XP_002877399.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297323237|gb|EFH53658.1| predicted protein [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 432 | ||||||
| FB|FBgn0003612 | 640 | Su(var)2-10 "Suppressor of var | 0.319 | 0.215 | 0.26 | 3.9e-12 | |
| ZFIN|ZDB-GENE-080220-27 | 1068 | zmiz1a "zinc finger, MIZ-type | 0.446 | 0.180 | 0.279 | 1.5e-11 | |
| UNIPROTKB|I3L8P9 | 943 | I3L8P9 "Uncharacterized protei | 0.446 | 0.204 | 0.279 | 4.9e-11 | |
| UNIPROTKB|I3LDU8 | 985 | I3LDU8 "Uncharacterized protei | 0.446 | 0.195 | 0.279 | 5.2e-11 | |
| UNIPROTKB|I3LJD1 | 1021 | ZMIZ1 "Uncharacterized protein | 0.446 | 0.189 | 0.279 | 5.5e-11 | |
| UNIPROTKB|F1MP12 | 1066 | ZMIZ1 "Uncharacterized protein | 0.446 | 0.181 | 0.279 | 5.8e-11 | |
| UNIPROTKB|Q9ULJ6 | 1067 | ZMIZ1 "Zinc finger MIZ domain- | 0.446 | 0.180 | 0.279 | 5.8e-11 | |
| UNIPROTKB|E2RGZ0 | 1072 | ZMIZ1 "Uncharacterized protein | 0.446 | 0.180 | 0.279 | 5.8e-11 | |
| UNIPROTKB|F1S2E4 | 1072 | ZMIZ1 "Uncharacterized protein | 0.446 | 0.180 | 0.279 | 5.8e-11 | |
| MGI|MGI:106374 | 920 | Zmiz2 "zinc finger, MIZ-type c | 0.449 | 0.210 | 0.276 | 7.9e-11 |
| FB|FBgn0003612 Su(var)2-10 "Suppressor of variegation 2-10" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 160 (61.4 bits), Expect = 3.9e-12, Sum P(2) = 3.9e-12
Identities = 39/150 (26%), Positives = 69/150 (46%)
Query: 285 NKIVLTGCD--ARIFCLGVRIVKRRSVQQVLNLIPKESEGEHFEDALTRVCRCVXXXXXX 342
N I + C R +CL V +VK+ + Q+L + +++G D TR
Sbjct: 301 NTITVQWCPDYTRSYCLAVYLVKKLTSTQLLQRM--KTKGVKPAD-YTR-------GLIK 350
Query: 343 XXXXXXXXLEVVADSIGVNLRCPMSGSRIKVAGRFKPCVHMGCFDLDVFVELNQRSRKWQ 402
E+ + V+L CP+ ++ + R C H+ CFD +++++N+R W
Sbjct: 351 EKLTEDADCEIATTMLKVSLNCPLGKMKMLLPCRASTCSHLQCFDASLYLQMNERKPTWN 410
Query: 403 CPICLRNYSLENIIIDPYFNRITSKVLFFS 432
CP+C + +N++ID YF + L S
Sbjct: 411 CPVCDKPAIYDNLVIDGYFQEVLGSSLLKS 440
|
|
| ZFIN|ZDB-GENE-080220-27 zmiz1a "zinc finger, MIZ-type containing 1a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L8P9 I3L8P9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LDU8 I3LDU8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LJD1 ZMIZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MP12 ZMIZ1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9ULJ6 ZMIZ1 "Zinc finger MIZ domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RGZ0 ZMIZ1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S2E4 ZMIZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:106374 Zmiz2 "zinc finger, MIZ-type containing 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| gw1.66.741.1 | hypothetical protein (636 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 432 | |||
| pfam02891 | 50 | pfam02891, zf-MIZ, MIZ/SP-RING zinc finger | 2e-17 | |
| pfam02037 | 35 | pfam02037, SAP, SAP domain | 7e-07 | |
| smart00513 | 35 | smart00513, SAP, Putative DNA-binding (bihelical) | 3e-06 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 4e-06 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 9e-06 |
| >gnl|CDD|111745 pfam02891, zf-MIZ, MIZ/SP-RING zinc finger | Back alignment and domain information |
|---|
Score = 75.4 bits (186), Expect = 2e-17
Identities = 22/47 (46%), Positives = 32/47 (68%)
Query: 360 VNLRCPMSGSRIKVAGRFKPCVHMGCFDLDVFVELNQRSRKWQCPIC 406
V+L+CP+S RI + R + C H+ CFDL F+E N+R+ W CP+C
Sbjct: 1 VSLKCPISYLRISIPVRGRFCKHIQCFDLLSFLESNERTPTWNCPVC 47
|
This domain has SUMO (small ubiquitin-like modifier) ligase activity and is involved in DNA repair and chromosome organisation. Length = 50 |
| >gnl|CDD|202100 pfam02037, SAP, SAP domain | Back alignment and domain information |
|---|
| >gnl|CDD|128789 smart00513, SAP, Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 432 | |||
| KOG2169 | 636 | consensus Zn-finger transcription factor [Transcri | 100.0 | |
| PF02891 | 50 | zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 | 99.88 | |
| PF14324 | 144 | PINIT: PINIT domain; PDB: 3I2D_A. | 99.81 | |
| PF11789 | 57 | zf-Nse: Zinc-finger of the MIZ type in Nse subunit | 98.61 | |
| PF02037 | 35 | SAP: SAP domain; InterPro: IPR003034 The SAP (afte | 98.6 | |
| smart00513 | 35 | SAP Putative DNA-binding (bihelical) motif predict | 98.46 | |
| KOG1973 | 274 | consensus Chromatin remodeling protein, contains P | 97.99 | |
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 97.75 | |
| KOG2979 | 262 | consensus Protein involved in DNA repair [General | 97.32 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 97.3 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 97.07 | |
| COG5034 | 271 | TNG2 Chromatin remodeling protein, contains PhD zi | 97.04 | |
| PF04564 | 73 | U-box: U-box domain; InterPro: IPR003613 Quality c | 96.41 | |
| KOG1844 | 508 | consensus PHD Zn-finger proteins [General function | 95.97 | |
| PF12949 | 35 | HeH: HeH/LEM domain; PDB: 2OUT_A. | 94.47 | |
| KOG4323 | 464 | consensus Polycomb-like PHD Zn-finger protein [Gen | 94.41 | |
| PLN03208 | 193 | E3 ubiquitin-protein ligase RMA2; Provisional | 94.39 | |
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 94.35 | |
| COG5627 | 275 | MMS21 DNA repair protein MMS21 [DNA replication, r | 94.29 | |
| COG5222 | 427 | Uncharacterized conserved protein, contains RING Z | 93.84 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 92.93 | |
| KOG4259 | 260 | consensus Putative nucleic acid-binding protein Hc | 91.13 | |
| PF07498 | 43 | Rho_N: Rho termination factor, N-terminal domain; | 91.03 | |
| TIGR00599 | 397 | rad18 DNA repair protein rad18. This family is bas | 89.08 | |
| KOG2164 | 513 | consensus Predicted E3 ubiquitin ligase [Posttrans | 88.18 | |
| PF04641 | 260 | Rtf2: Rtf2 RING-finger | 87.24 | |
| PF10208 | 154 | Armet: Degradation arginine-rich protein for mis-f | 82.83 | |
| cd00162 | 45 | RING RING-finger (Really Interesting New Gene) dom | 81.24 |
| >KOG2169 consensus Zn-finger transcription factor [Transcription] | Back alignment and domain information |
|---|
Probab=100.00 E-value=9.8e-37 Score=328.99 Aligned_cols=355 Identities=19% Similarity=0.352 Sum_probs=246.4
Q ss_pred hhcCHHHHHHHH-HHhCCCCCC--ChHHHHHHHHHhcccccccccccCCCCCcHHHHHHHHHHHHHhccc-CCCCCcccC
Q 014025 12 AHFRIKELKDVL-TQLGLSKQG--KKQDLVDRILAILSDDQVSKMWAKKSPVSKEEVAKLVDDTHRKLQV-SVAPDLASK 87 (432)
Q Consensus 12 ~~fRv~ELk~vl-~~lgl~ksG--rK~eL~~Ril~~l~~~~~~~~~~~~~~~~~~~~~~~i~~~y~~~~~-~~~~~~~~~ 87 (432)
+++|+.||+.++ .+.|+...| +|.+|.-|.+.++...+.+ ++..+|.+.|++... .......-.
T Consensus 1 m~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~r~l~~~~~~~~~------------~~q~~i~~~~~~~~~~~~~~~~~~~ 68 (636)
T KOG2169|consen 1 MSLRVSSLQVLLSGAIGRSFPGQVNKHKLAPRALTLVGSGCKP------------YLQMVIKELYQRQYPNGQQQPIDLP 68 (636)
T ss_pred CCcccccccccchhhhccccccccchhhhhhhhhcccccCCch------------hhhhhhhhhhhhhcccccccccccc
Confidence 368999999998 788888888 8899999999999888755 778888899885222 221111010
Q ss_pred CCCCcCCCCcccccccccccCCCCCccccCCCCCCCCCCeeeecCCCCCCcccccceecCCCCCCCCCCCCCccccccee
Q 014025 88 GGQGVSNSSNIKIKGEMDDYIQSDTKVCCPCGSSLETESMIKCEDPRCPVWQHMSCVIIPEKPTEGNPPVPELFYCEICR 167 (432)
Q Consensus 88 ~~~~~~~~~~~~~~~~~~~~~q~~~~~rC~Cg~~~~~~~~i~C~~~~C~~~qH~~Cv~~~~k~~~~~~~~p~~f~C~~Cr 167 (432)
. ...+.+..+. .+.. . |....|..=..+....+.+ +..-+.+..+
T Consensus 69 ~---~~~~~~~~~~-----~~~~---------------~--------~~~~~~~~~~~~~~~~l~g----~~~~~~~~~~ 113 (636)
T KOG2169|consen 69 A---VKLHPNVVPP-----FYPL---------------L--------WQLLRHPTQQPVTPSSLLG----PPLPFHPDVK 113 (636)
T ss_pred c---cccCCcccCc-----cccc---------------h--------hcccccCCCCCCCcccccC----CCCcCCCccc
Confidence 0 0011111100 0000 0 0001111000011111111 0023456677
Q ss_pred ecccCcchhhccccccceeeeecccCCCCCCCceeeeEEEEeChhhHHhhccC-Ce------eEEEEEeecCCCCccccC
Q 014025 168 LSRADPFWVTIGHPLYPLKLTTTNIPTDGTNPARILEKTFPITRADKDLLSKQ-EY------DVQAWCMLLNDKVPFRMQ 240 (432)
Q Consensus 168 l~~~dPF~~~i~~ll~p~~l~~~~i~~~g~~~~q~~~~~F~Lt~~~~~~l~~~-~~------~l~v~C~~~~~~~~~~~~ 240 (432)
+ +..|||.++..+.+|+.+..+. + ..++...+.|.|+++....+... +. .-.+ |.. ..+.+++.+
T Consensus 114 ~-~~~~~y~~l~~~~~p~~~~~~~----~-~~~~~~~~~f~lt~~~~~~i~~~~~~~~~~k~~~~~-~~~-~~s~p~e~~ 185 (636)
T KOG2169|consen 114 L-KKLPFYDVLSELIKPHVLHSSN----S-PSLSESPFLFALTPEQVSGISSRPDVLPGSKSEGSV-CLM-ETSCPQEDH 185 (636)
T ss_pred c-cCCchheecccccCceeecCcC----C-CCcccccchhhcchhhhhhcccccccccccccccce-eec-cccCccccc
Confidence 7 5699999999999998887642 2 34455678899999998776532 10 0111 433 245678999
Q ss_pred CCceeeEEECCeeeecc-CCCCCCCCCC-CCCCCCCC-ccc--CcCCc-ccEEEEEEe--ccceEEEEEEEEEecCHHHH
Q 014025 241 WPQYADLQVNGVPVRAI-NRPGSQLLGA-NGRDDGPI-ITP--WTKDG-INKIVLTGC--DARIFCLGVRIVKRRSVQQV 312 (432)
Q Consensus 241 wP~~~~i~vNg~~v~~~-~r~~~~~~g~-~~r~~~~~-IT~--~l~~g-~N~I~i~~~--d~~~y~~~v~lVk~~s~~~l 312 (432)
||.++.++||+..+.+. ..-..++.+. .++...|. ||. ++... .|.+.+.|. .++.|.+++|+|+.++.++|
T Consensus 186 ~p~~~~~~vn~~~~~l~~~~~~~n~~~~~~~~~~~P~n~t~~~~~~~~~~~~~~~~~~~~~~~~ysl~~~~v~~~t~~~l 265 (636)
T KOG2169|consen 186 FPPNVQVKVNNSPCQLPFGYMPNNKHGLEPKRPSRPGNITSLSRLSVTTPNQITVLWTAQGGKSYSLSVYFVEGLTSKDL 265 (636)
T ss_pred cCceeEEEecCCcceeeccccCCCCcccccCCCCCCCcCcccccccccccccceEEEEeccCcccceEEEEecccCHHHH
Confidence 99999999999998875 2112222222 25655666 999 44443 377777664 48899999999999999999
Q ss_pred HhhcccCCC-CCCHHHHHHHHHHHhCCCCCCCCCCCCCCcceEeeceeeeecCCCccccccccccccCcCccccccHHHH
Q 014025 313 LNLIPKESE-GEHFEDALTRVCRCVGGGNAADNADSDSDLEVVADSIGVNLRCPMSGSRIKVAGRFKPCVHMGCFDLDVF 391 (432)
Q Consensus 313 l~~I~~~~~-~~~~e~~~~~ik~~l~~~~~~~~~d~D~D~ev~~~~~~isL~CPls~~ri~~P~Rg~~C~HlQCFDl~~f 391 (432)
+++++...+ ...++.+.+.|++.+. .|+|.||+++++.|||.|||+++||++|+|+..|+|+|||||.+|
T Consensus 266 lq~~~~~~~~~~~~~~s~~~~~~~l~---------~~~d~~i~tt~~~vSL~CPl~~~Rm~~P~r~~~CkHlQcFD~~~~ 336 (636)
T KOG2169|consen 266 LQRLKQNGKINRNLSQSDALIKKKLT---------AGPDSEIATTSLRVSLNCPLSKMRMSLPARGHTCKHLQCFDALSY 336 (636)
T ss_pred HHHHhccCCccCchhHhHHHhhcccc---------cCCcccceeccceeEecCCcccceeecCCcccccccceecchhhh
Confidence 999987542 2334778888876543 234557999999999999999999999999999999999999999
Q ss_pred HHHhcCCCceecCCCCCCCCCCCeeecHHHHHHHHHhhc
Q 014025 392 VELNQRSRKWQCPICLRNYSLENIIIDPYFNRITSKVLF 430 (432)
Q Consensus 392 L~~n~~~~~W~CPiC~k~~~~~~L~ID~y~~~Il~~~~~ 430 (432)
|+||+++++|+||||++.+.+++|+||+||.+||..+..
T Consensus 337 lq~n~~~pTW~CPVC~~~~~~e~l~iD~~~~~iL~~~~~ 375 (636)
T KOG2169|consen 337 LQMNEQKPTWRCPVCQKAAPFEGLIIDGYFLNILQSCQA 375 (636)
T ss_pred HHhccCCCeeeCccCCccccccchhhhHHHHHHHhhccC
Confidence 999999999999999999999999999999999988754
|
|
| >PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14324 PINIT: PINIT domain; PDB: 3I2D_A | Back alignment and domain information |
|---|
| >PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C | Back alignment and domain information |
|---|
| >PF02037 SAP: SAP domain; InterPro: IPR003034 The SAP (after SAF-A/B, Acinus and PIAS) motif is a putative DNA binding domain found in diverse nuclear proteins involved in chromosomal organisation [], including in apoptosis [] | Back alignment and domain information |
|---|
| >smart00513 SAP Putative DNA-binding (bihelical) motif predicted to be involved in chromosomal organisation | Back alignment and domain information |
|---|
| >KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2979 consensus Protein involved in DNA repair [General function prediction only] | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis | Back alignment and domain information |
|---|
| >KOG1844 consensus PHD Zn-finger proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF12949 HeH: HeH/LEM domain; PDB: 2OUT_A | Back alignment and domain information |
|---|
| >KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >COG5627 MMS21 DNA repair protein MMS21 [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >KOG4259 consensus Putative nucleic acid-binding protein Hcc-1/proliferation associated cytokine-inducible protein, contains SAP domain [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF07498 Rho_N: Rho termination factor, N-terminal domain; InterPro: IPR011112 The Rho termination factor disengages newly transcribed RNA from its DNA template at certain, specific transcripts | Back alignment and domain information |
|---|
| >TIGR00599 rad18 DNA repair protein rad18 | Back alignment and domain information |
|---|
| >KOG2164 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF04641 Rtf2: Rtf2 RING-finger | Back alignment and domain information |
|---|
| >PF10208 Armet: Degradation arginine-rich protein for mis-folding; InterPro: IPR019345 This entry represents Armet proteins (aka mesencephalic astrocyte-derived neurotrophic factor or arginine-rich protein) | Back alignment and domain information |
|---|
| >cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 432 | ||||
| 2rno_A | 110 | Solution Structure Of The N-Terminal Sap Domain Of | 1e-26 | ||
| 1wew_A | 78 | Solution Structure Of Phd Domain In Dna-Binding Fam | 3e-21 | ||
| 2rsd_A | 68 | Solution Structure Of The Plant Homeodomain (Phd) O | 3e-16 | ||
| 4fo9_A | 360 | Crystal Structure Of The E3 Sumo Ligase Pias2 Lengt | 9e-10 | ||
| 3i2d_A | 371 | Crystal Structure Of S. Cerevisiae Sumo E3 Ligase S | 1e-07 |
| >pdb|2RNO|A Chain A, Solution Structure Of The N-Terminal Sap Domain Of Sumo E3 Ligases From Oryza Sativa Length = 110 | Back alignment and structure |
|
| >pdb|1WEW|A Chain A, Solution Structure Of Phd Domain In Dna-Binding Family Protein Aam98074 Length = 78 | Back alignment and structure |
| >pdb|2RSD|A Chain A, Solution Structure Of The Plant Homeodomain (Phd) Of The E3 Sumo Ligase Siz1 From Rice Length = 68 | Back alignment and structure |
| >pdb|4FO9|A Chain A, Crystal Structure Of The E3 Sumo Ligase Pias2 Length = 360 | Back alignment and structure |
| >pdb|3I2D|A Chain A, Crystal Structure Of S. Cerevisiae Sumo E3 Ligase Siz1 Length = 371 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 432 | |||
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 5e-49 | |
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 2e-45 | |
| 2rno_A | 110 | Putative DNA-binding protein; SUMO ligase, sumoyla | 1e-38 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 4e-23 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 7e-23 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 2e-12 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 3e-12 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 6e-11 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 5e-10 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 9e-09 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 2e-08 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 4e-08 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-08 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 9e-08 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 1e-07 | |
| 1jjr_A | 151 | KU70, thyroid autoantigen; DNA repair protein, pro | 2e-07 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 3e-07 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 3e-07 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 7e-07 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 2e-06 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 2e-06 | |
| 1v66_A | 65 | Protein inhibitor of activated STAT protein 1; fou | 3e-06 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 1e-05 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 3e-05 | |
| 2rnn_A | 114 | E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA bind | 5e-05 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 2e-04 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 7e-04 | |
| 1jey_A | 609 | KU70; double-strand DNA break repair, non-homologo | 8e-04 |
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
Score = 170 bits (430), Expect = 5e-49
Identities = 54/257 (21%), Positives = 110/257 (42%), Gaps = 21/257 (8%)
Query: 181 PLYPLK--LTTTNIPTDGTNPARILEKTFPITRADKDLLSK--QEYDVQAWCML---LND 233
P Y ++ + + + T + F +++AD +LLS ++ + + + L
Sbjct: 72 PFYKIQRLIPELVMNVEVTGGRGMCSAKFKLSKADYNLLSNPNSKHRLYLFSGMINPLGS 131
Query: 234 KVPFRMQWPQYADLQVNGVPVRAINRPGSQLLG-ANGRDDGPIITPWTKDGINKIVLT-G 291
+ +Q+P +L+ N V ++ R G A D P + P+T N + L
Sbjct: 132 RGNEPIQFPFPNELRCNNVQIKDNIRGFKSKPGTAKPADLTPHLKPYT--QQNNVELIYA 189
Query: 292 CDARIFCLGVRIVKRRSVQQVLNLIPKESEGEHFEDALTRVCRCVGGGNAADNADSDSDL 351
+ + L IV+ + +Q+L + + + + L + + D ++
Sbjct: 190 FTTKEYKLFGYIVEMITPEQLLEKVLQHPK-IIKQATLLYLKK---------TLREDEEM 239
Query: 352 EVVADSIGVNLRCPMSGSRIKVAGRFKPCVHMGCFDLDVFVELNQRSRKWQCPICLRNYS 411
+ S ++L+CP+S +R+K + C H+ CFD F+ + WQCP+C + +
Sbjct: 240 GLTTTSTIMSLQCPISYTRMKYPSKSINCKHLQCFDALWFLHSQLQIPTWQCPVCQIDIA 299
Query: 412 LENIIIDPYFNRITSKV 428
LEN+ I + + I
Sbjct: 300 LENLAISEFVDDILQNC 316
|
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Length = 360 | Back alignment and structure |
|---|
| >2rno_A Putative DNA-binding protein; SUMO ligase, sumoylation, metal-BI zinc-finger, ligase; NMR {Oryza sativa subsp} Length = 110 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Length = 267 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Length = 62 | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Length = 90 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >1v66_A Protein inhibitor of activated STAT protein 1; four helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.140.2.1 Length = 65 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >2rnn_A E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA binding, sumoylation, metal-binding, nucLeu phosphoprotein, UBL conjugation pathway; NMR {Saccharomyces cerevisiae} Length = 114 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >1jey_A KU70; double-strand DNA break repair, non-homologous END-joining, protein/nucleic acid complex, alpha/beta domain, beta barrel; HET: DNA; 2.50A {Homo sapiens} SCOP: b.131.1.1 c.62.1.3 PDB: 1jeq_A* 3rzx_B Length = 609 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 432 | |||
| 4fo9_A | 360 | E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom | 100.0 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 100.0 | |
| 2rno_A | 110 | Putative DNA-binding protein; SUMO ligase, sumoyla | 99.96 | |
| 1v66_A | 65 | Protein inhibitor of activated STAT protein 1; fou | 99.74 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 99.37 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 99.2 | |
| 3htk_C | 267 | E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- | 98.94 | |
| 2rnn_A | 114 | E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA bind | 98.93 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 98.65 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 98.63 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 98.6 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 98.43 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 98.38 | |
| 2do1_A | 55 | Nuclear protein HCC-1; SAP domain, structural geno | 98.36 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 98.33 | |
| 1zrj_A | 50 | E1B-55KDA-associated protein 5 isoform C; SAP doma | 98.28 | |
| 1h1j_S | 51 | THO1 protein; SAP domain, DNA binding; NMR {Saccha | 98.24 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 98.23 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 98.22 | |
| 2kvu_A | 75 | MKL/myocardin-like protein 1; SAP motif, DNA/RNA b | 98.19 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 98.15 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 97.99 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 97.98 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 97.97 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 97.85 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 97.84 | |
| 1jjr_A | 151 | KU70, thyroid autoantigen; DNA repair protein, pro | 97.83 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 97.8 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 97.7 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 97.66 | |
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 97.59 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 97.56 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 97.44 | |
| 2yu4_A | 94 | E3 SUMO-protein ligase NSE2; SP-ring domain, struc | 97.33 | |
| 2kr4_A | 85 | Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri | 97.23 | |
| 1wgm_A | 98 | Ubiquitin conjugation factor E4A; ubiquitinating e | 97.15 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 96.73 | |
| 3ztg_A | 92 | E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR | 96.73 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 96.68 | |
| 2bay_A | 61 | PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l | 96.67 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 96.44 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 96.36 | |
| 2f42_A | 179 | STIP1 homology and U-box containing protein 1; cha | 96.21 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 96.2 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 96.16 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 96.16 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 96.15 | |
| 2ckl_B | 165 | Ubiquitin ligase protein RING2; BMI1, RING1B, poly | 96.08 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 95.95 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 95.93 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 95.83 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 95.77 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 95.6 | |
| 2ckl_A | 108 | Polycomb group ring finger protein 4; BMI1, RING1B | 95.51 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 95.51 | |
| 3fl2_A | 124 | E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA | 95.47 | |
| 2jx3_A | 131 | Protein DEK; alpha helix, SAF/SAP motif, DNA bindi | 95.46 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 95.22 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 95.11 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 95.08 | |
| 3hct_A | 118 | TNF receptor-associated factor 6; cross-brace, bet | 95.07 | |
| 1z6u_A | 150 | NP95-like ring finger protein isoform B; structura | 95.01 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 94.92 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 94.73 | |
| 2ecw_A | 85 | Tripartite motif-containing protein 30; metal bind | 94.42 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 94.18 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 94.09 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 93.91 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 93.86 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 93.74 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 93.47 | |
| 3hcs_A | 170 | TNF receptor-associated factor 6; cross-brace, bet | 93.43 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 93.42 | |
| 2ecv_A | 85 | Tripartite motif-containing protein 5; metal bindi | 93.35 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 93.34 | |
| 1rmd_A | 116 | RAG1; V(D)J recombination, antibody, MAD, ring fin | 93.12 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 93.11 | |
| 2yur_A | 74 | Retinoblastoma-binding protein 6; P53-associated c | 92.79 | |
| 3l11_A | 115 | E3 ubiquitin-protein ligase RNF168; E3 ligase, rin | 92.62 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 92.52 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 92.34 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 92.08 | |
| 2egp_A | 79 | Tripartite motif-containing protein 34; ZF-C3HC4 d | 91.86 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 91.77 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 91.56 | |
| 3ask_A | 226 | E3 ubiquitin-protein ligase UHRF1; histone reader | 91.05 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 90.41 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 90.26 | |
| 3knv_A | 141 | TNF receptor-associated factor 2; cross-brace, alt | 89.45 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 89.35 | |
| 2ect_A | 78 | Ring finger protein 126; metal binding protein, st | 89.32 | |
| 2do5_A | 58 | Splicing factor 3B subunit 2; SAP domain, structur | 89.21 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 89.16 | |
| 1kcf_A | 258 | Hypothetical 30.2 KD protein C25G10.02 in chromoso | 88.78 | |
| 2d8t_A | 71 | Dactylidin, ring finger protein 146; RNF146, ring | 88.34 | |
| 1x4j_A | 75 | Ring finger protein 38; structural genomics, NPPSF | 87.92 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 87.81 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 87.6 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 87.2 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 86.43 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 86.25 | |
| 2ct2_A | 88 | Tripartite motif protein 32; zinc-finger protein H | 85.86 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 84.92 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 84.26 | |
| 1bor_A | 56 | Transcription factor PML; proto-oncogene, nuclear | 84.25 | |
| 2ysj_A | 63 | Tripartite motif-containing protein 31; ring-type | 83.83 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 83.16 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 83.03 | |
| 2ep4_A | 74 | Ring finger protein 24; zinc binding, ubiquitin, E | 82.97 | |
| 2ecj_A | 58 | Tripartite motif-containing protein 39; TRIM39, ri | 82.54 | |
| 2ecg_A | 75 | Baculoviral IAP repeat-containing protein 4; BIRC4 | 80.94 |
| >4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-53 Score=421.37 Aligned_cols=251 Identities=20% Similarity=0.392 Sum_probs=200.3
Q ss_pred cccceeecccCcchhhccccccceeeeecccCCCCCCCceeeeEEEEeChhhHHhhccC---------CeeEEE---EEe
Q 014025 162 YCEICRLSRADPFWVTIGHPLYPLKLTTTNIPTDGTNPARILEKTFPITRADKDLLSKQ---------EYDVQA---WCM 229 (432)
Q Consensus 162 ~C~~Crl~~~dPF~~~i~~ll~p~~l~~~~i~~~g~~~~q~~~~~F~Lt~~~~~~l~~~---------~~~l~v---~C~ 229 (432)
+.|..+| +.+|||+++++|++|+.|.++ ++..+|...+.|.||++|...+... +|++|| +|.
T Consensus 14 ~~~~~~~-k~lPFy~v~~~l~~Pt~L~~~-----~~~~~~~~~f~f~lt~~q~~~i~~~~~~~~~~~~~~~vqvqlRfC~ 87 (360)
T 4fo9_A 14 LYFQGQL-KNLPFYDVLDVLIKPTSLVQS-----SIQRFQEKFFIFALTPQQVREICISRDFLPGGRRDYTVQVQLRLCL 87 (360)
T ss_dssp ---CCCB-CCCTTEEEEEEEEEEEECCCC-----SSCSEEEEEEEECCCHHHHHHHHTCEEECTTSCEEESEEEEEEEEE
T ss_pred cCCCcee-cCCCchHhHhhhcCceecccc-----cCcccccceeEEEcCHHHHHHHhhccccccccccceeEEEEEEEEE
Confidence 4566788 558999999999999999764 3566888999999999999888632 355555 475
Q ss_pred ecCCCCccccCCCceeeEEECCeeeeccCCCCCCCCCCC-CCCCCCC-cccCcCCc---ccEEEEEEe-c-cceEEEEEE
Q 014025 230 LLNDKVPFRMQWPQYADLQVNGVPVRAINRPGSQLLGAN-GRDDGPI-ITPWTKDG---INKIVLTGC-D-ARIFCLGVR 302 (432)
Q Consensus 230 ~~~~~~~~~~~wP~~~~i~vNg~~v~~~~r~~~~~~g~~-~r~~~~~-IT~~l~~g---~N~I~i~~~-d-~~~y~~~v~ 302 (432)
. ++++++++.||.+++|+|||+.++.++.-+.++.|.. +|...|+ ||++++.| .|+|+|+|+ + ++.|+++||
T Consensus 88 ~-~~~~~q~~~fP~~i~lkVNg~~v~lp~~~p~~k~g~~~kr~~~PidIT~~lr~~~~~~N~I~vt~~~~~~~~y~l~V~ 166 (360)
T 4fo9_A 88 A-ETSCPQEDNYPNSLCIKVNGKLFPLPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVY 166 (360)
T ss_dssp C--C-CCBCCBCCTTCEEEETTEEECCCC--------CCCCCBCCCEECGGGSCCCSSSCEEEEEEEECBTTBCEEEEEE
T ss_pred c-cCCCcccccCCCceEEEECCEEccCCCCCCCcccccccCCCCCceechhhhccCCCCCcEEEEEEecCCCceEEEEEE
Confidence 4 5677899999999999999999997542223344433 4444444 99999987 599999997 3 689999999
Q ss_pred EEEecCHHHHHhhcccCCCCCCHHHHHHHHHHHhCCCCCCCCCCCCCCcceEeeceeeeecCCCccccccccccccCcCc
Q 014025 303 IVKRRSVQQVLNLIPKESEGEHFEDALTRVCRCVGGGNAADNADSDSDLEVVADSIGVNLRCPMSGSRIKVAGRFKPCVH 382 (432)
Q Consensus 303 lVk~~s~~~ll~~I~~~~~~~~~e~~~~~ik~~l~~~~~~~~~d~D~D~ev~~~~~~isL~CPls~~ri~~P~Rg~~C~H 382 (432)
+|+++|+++|+++|+++ +..+.+++++.|+++++. |+|+||+++++.|||+||||++||++||||..|.|
T Consensus 167 lV~~~s~~~Llq~l~~k-~~~~~e~t~~~Ik~~l~~---------d~DddI~~~~~~vSL~CPlS~~ri~~P~Rg~~C~H 236 (360)
T 4fo9_A 167 LVRQLTSAMLLQRLKMK-GIRNPDHSRALIKEKLTA---------DPDSEIATTSLRVSLMCPLGKMRLTIPCRAVTCTH 236 (360)
T ss_dssp EEEECCHHHHHHHHHTC--CBCHHHHHHHHHHHHC------------------CCEEEESBCTTTCSBCSSEEEETTCCC
T ss_pred EEEeCCHHHHHHHHHhc-CCCCHHHHHHHHHHHhcc---------CCccceeeeeeEEeeeCCCccceeccCCcCCCCCC
Confidence 99999999999999874 357789999999998842 23446888999999999999999999999999999
Q ss_pred cccccHHHHHHHhcCCCceecCCCCCCCCCCCeeecHHHHHHHHHhh
Q 014025 383 MGCFDLDVFVELNQRSRKWQCPICLRNYSLENIIIDPYFNRITSKVL 429 (432)
Q Consensus 383 lQCFDl~~fL~~n~~~~~W~CPiC~k~~~~~~L~ID~y~~~Il~~~~ 429 (432)
+|||||++||+||++.++|+||||++.+++++|+||+||++||+.+.
T Consensus 237 lqCFDl~sfL~~~~~~~~W~CPiC~k~~~~~dL~ID~~~~~IL~~~~ 283 (360)
T 4fo9_A 237 LQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCS 283 (360)
T ss_dssp CCCEEHHHHHHHHHHSCCCBCTTTCSBCCGGGEEEBHHHHHHHTTCS
T ss_pred CccCCHHHHHHHHhhCCCeECCCCCcccCHHHeEEcHHHHHHHHhCC
Confidence 99999999999999999999999999999999999999999998753
|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rno_A Putative DNA-binding protein; SUMO ligase, sumoylation, metal-BI zinc-finger, ligase; NMR {Oryza sativa subsp} | Back alignment and structure |
|---|
| >1v66_A Protein inhibitor of activated STAT protein 1; four helix bundle, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.140.2.1 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2rnn_A E3 SUMO-protein ligase SIZ1; SUMO ligase, DNA binding, sumoylation, metal-binding, nucLeu phosphoprotein, UBL conjugation pathway; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2do1_A Nuclear protein HCC-1; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1zrj_A E1B-55KDA-associated protein 5 isoform C; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.140.2.1 | Back alignment and structure |
|---|
| >1h1j_S THO1 protein; SAP domain, DNA binding; NMR {Saccharomyces cerevisiae} SCOP: a.140.2.1 PDB: 2wqg_A | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kvu_A MKL/myocardin-like protein 1; SAP motif, DNA/RNA binding, structural genomics, northeast structural genomics consortium (NESG), PSI-2; NMR {Homo sapiens} PDB: 2kw9_A | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2jx3_A Protein DEK; alpha helix, SAF/SAP motif, DNA binding, chromosomal rearrangement, DNA-binding, nucleus, phosphorylation, proto oncogene; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A | Back alignment and structure |
|---|
| >1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2do5_A Splicing factor 3B subunit 2; SAP domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1kcf_A Hypothetical 30.2 KD protein C25G10.02 in chromosome I; beta-alpha-beta motif, RUVC resolvase family, hydrolase; 2.30A {Schizosaccharomyces pombe} SCOP: a.140.2.1 c.55.3.7 | Back alignment and structure |
|---|
| >2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 432 | ||||
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 5e-18 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 1e-11 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 8e-08 | |
| d1jeqa1 | 51 | a.140.2.1 (A:559-609) DNA binding C-terminal domai | 8e-08 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 1e-07 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 5e-06 | |
| d1wesa_ | 71 | g.50.1.2 (A:) PHD Inhibitor of growth protein 2, I | 8e-06 | |
| d1v66a_ | 65 | a.140.2.1 (A:) p53 binding domain of protein inhib | 3e-05 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 4e-05 | |
| d1zrja1 | 37 | a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucle | 2e-04 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 2e-04 | |
| d1h1js_ | 44 | a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Bak | 6e-04 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 8e-04 | |
| d1jm7a_ | 103 | g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie | 0.004 |
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
class: Small proteins fold: FYVE/PHD zinc finger superfamily: FYVE/PHD zinc finger family: PHD domain domain: Sumoylation ligase E3, SIZ1 species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 75.9 bits (186), Expect = 5e-18
Identities = 44/66 (66%), Positives = 55/66 (83%)
Query: 105 DDYIQSDTKVCCPCGSSLETESMIKCEDPRCPVWQHMSCVIIPEKPTEGNPPVPELFYCE 164
+D Q + KV C CG+SLET+SMI+CEDPRC VWQH+ CVI+P+KP +GNPP+PE FYCE
Sbjct: 8 EDPFQPEIKVRCVCGNSLETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCE 67
Query: 165 ICRLSR 170
ICRL+
Sbjct: 68 ICRLTS 73
|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 71 | Back information, alignment and structure |
|---|
| >d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d1h1js_ a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 44 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 432 | |||
| d1v66a_ | 65 | p53 binding domain of protein inhibitor of activat | 99.77 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 98.78 | |
| d1jeqa1 | 51 | DNA binding C-terminal domain of ku70 {Human (Homo | 98.74 | |
| d1zrja1 | 37 | Heterogeneous nuclear ribonucleoprotein U-like pro | 98.47 | |
| d1h1js_ | 44 | S/mar DNA-binding protein Tho1 {Baker's yeast (Sac | 98.23 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 98.22 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 98.06 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 97.93 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 97.93 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 97.85 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 97.6 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 97.58 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 97.36 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.32 | |
| d1wgma_ | 98 | Ubiquitin conjugation factor E4A {Human (Homo sapi | 97.06 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 97.01 | |
| d2do1a1 | 42 | Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId | 97.01 | |
| d1kcfa1 | 36 | Mitochondrial resolvase ydc2 N-terminal domain {Fi | 96.78 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 96.75 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 96.01 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 95.99 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 95.87 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 94.68 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 94.1 | |
| d1fbva4 | 79 | CBL {Human (Homo sapiens) [TaxId: 9606]} | 91.8 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 87.83 | |
| d1g25a_ | 65 | TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 | 86.68 | |
| d1a62a1 | 47 | Rho termination factor, N-terminal domain {Escheri | 86.43 | |
| d1y02a1 | 44 | Rififylin (FYVE-RING finger protein Sakura) {Human | 85.48 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 83.07 |
| >d1v66a_ a.140.2.1 (A:) p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: LEM/SAP HeH motif superfamily: SAP domain family: SAP domain domain: p53 binding domain of protein inhibitor of activated STAT protein 1, PIAS-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77 E-value=2.5e-19 Score=131.46 Aligned_cols=65 Identities=25% Similarity=0.374 Sum_probs=60.0
Q ss_pred CccHHHHHHHHhhcCHHHHHHHHHHhCCCCCCChHHHHHHHHHhcccccccccccCCCCCcHHHHHHHHHHHHHhcc
Q 014025 1 MDSVASCKEKLAHFRIKELKDVLTQLGLSKQGKKQDLVDRILAILSDDQVSKMWAKKSPVSKEEVAKLVDDTHRKLQ 77 (432)
Q Consensus 1 ~~~~~~~~~~l~~fRv~ELk~vl~~lgl~ksGrK~eL~~Ril~~l~~~~~~~~~~~~~~~~~~~~~~~i~~~y~~~~ 77 (432)
|+.+.+.++||++|||+|||.+|+++|++|||||+||++|++.||+..+.+ ++...|.|+|+++.
T Consensus 1 mad~~e~~~Mv~sfRVsELQ~LLg~~gr~KsGrK~eL~~RaL~LL~~~~~~------------~v~~kIrelY~~R~ 65 (65)
T d1v66a_ 1 MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSP------------AVQMKIKELYRRRF 65 (65)
T ss_dssp CCCTTHHHHHHTTCCHHHHHHHHHTTCCCCCSCHHHHHHHHHHHHHTCCCH------------HHHHHHHHHHHHTC
T ss_pred CchHHHHHHHHHHHhHHHHHHHHHHcCCCCcccHHHHHHHHHHHHhcCCCH------------HHHHHHHHHHHccC
Confidence 889999999999999999999999999999999999999999999987654 67777999999863
|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jeqa1 a.140.2.1 (A:559-609) DNA binding C-terminal domain of ku70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zrja1 a.140.2.1 (A:1-37) Heterogeneous nuclear ribonucleoprotein U-like protein 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h1js_ a.140.2.1 (S:) S/mar DNA-binding protein Tho1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2do1a1 a.140.2.1 (A:5-46) Nuclear protein hcc-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcfa1 a.140.2.1 (A:3-38) Mitochondrial resolvase ydc2 N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a62a1 a.140.3.1 (A:1-47) Rho termination factor, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1y02a1 a.140.2.1 (A:71-114) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|