Citrus Sinensis ID: 014028


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--
MHRLPEEFLEELKNGLRAILECNGGSHQREEFLTLQRFVQGRSDLTAKTLIRAHRVHLEILVAINSGIQAFLHPNISLSQTSLIEVFVYKRCRNIACQTQLPADDCTCEICTHRNGFCNLCMCVICNKFDFEVNTCRWIGCDLCSHWTHTDCAIRDGQICMGPSAKSGACPSEMLFRCRACNRTSELLGWVKDVFQHCAPAWDREALMRELDFVSRIFRGSEDPRGRKLYWKCEELLEKMKGGLPESMACRGILLFFQELEVDSPKSLENGEAGRLIAPHEACNRIAEVVQEAIRKMEMVADEKMRMFKKARLSLDACDRELEDKAREVTELQMERTKKKQQIEELEKIVRLKQAEADMFQLKANEAKREAERLQRIALAKTDKSEEEYASSYLKLRLSEAEAEKQYLFEKIKLQESSRASQSGGGMNLHRC
cccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHHcccccccccccccccccccEEEcccccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccc
********LEELKNGLRAILECNGGSHQREEFLTLQRFVQGRSDLTAKTLIRAHRVHLEILVAINSGIQAFLHPNISLSQTSLIEVFVYKRCRNIACQTQLPADDCTCEICTHRNGFCNLCMCVICNKFDFEVNTCRWIGCDLCSHWTHTDCAIRDGQICMGPSAKSGACPSEMLFRCRACNRTSELLGWVKDVFQHCAPAWDREALMRELDFVSRIFRGSEDPRGRKLYWKCEELLEKMKGGLPESMACRGILLFFQELEV********************CNRIAEVVQEAIRKMEMV***********************************************KIVRLKQAEADMFQL****************************SSYLKL************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHRLPEEFLEELKNGLRAILECNGGSHQREEFLTLQRFVQGRSDLTAKTLIRAHRVHLEILVAINSGIQAFLHPNISLSQTSLIEVFVYKRCRNIACQTQLPADDCTCEICTHRNGFCNLCMCVICNKFDFEVNTCRWIGCDLCSHWTHTDCAIRDGQICMGPSAKSGACPSEMLFRCRACNRTSELLGWVKDVFQHCAPAWDREALMRELDFVSRIFRGSEDPRGRKLYWKCEELLEKMKGGLPESMACRGILLFFQELEVDSPKSLENGEAGRLIAPHEACNRIAEVVQEAIRKMEMVADEKMRMFKKARLSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSEEEYASSYLKLRLSEAEAEKQYLFEKIKLQESSRASQSGGGMNLHRC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein OBERON 2 Together with OBE1, required for the maintenance and/or establishment of both the shoot and root meristems, probably by controlling the expression of the meristem genes such as WUS, PLT1 and PLT2 and of genes required for auxin responses. Promotes cell meristematic activity via the WUSCHEL-CLAVATA pathway. Involved in the development of the basal pole and in auxin-mediated root and vascular development in the embryo. Confers sensitivity to turnip mosaic virus (TuMV) probably by promoting viral movement and multiplication via interaction with TuMV VPg.probableQ9LUB7
OBERON-like protein (Fragment) Required for the maintenance and/or establishment of both the shoot and root meristems, probably by controlling the expression of the meristem genes and of genes required for auxin responses. Involved in the development of the basal pole and in auxin-mediated root and vascular development in the embryo (By similarity). Confers sensitivity to turnip mosaic virus (TuMV) probably by promoting viral movement and multiplication via interaction with TuMV VPg.probableQ84N37
OBERON-like protein Required for the maintenance and/or establishment of both the shoot and root meristems, probably by controlling the expression of the meristem genes and of genes required for auxin responses. Involved in the development of the basal pole and in auxin-mediated root and vascular development in the embryo (By similarity). Confers sensitivity to turnip mosaic virus (TuMV) probably by promoting viral movement and multiplication via interaction with TuMV VPg.probableQ84N38

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K16, chain A
Confidence level:confident
Coverage over the Query: 122-183
View the alignment between query and template
View the model in PyMOL
Template: 3ASK, chain A
Confidence level:probable
Coverage over the Query: 105-152,163-182
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 344-412
View the alignment between query and template
View the model in PyMOL