Citrus Sinensis ID: 014039

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430--

MERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHPNIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNGYFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAIDMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEILPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHDPLELRLNNMGSKPNLELNLWDFGTEPDDCFLGLTLAVKPSNLEMVHNVPQGMQEDILFCSDLKDHSEQTVFWSLLSPDQNRMRAPVESSLSLSFSSIQHPSTGVPQSAGYAITSLQPNLLDCPFLAVSSPLQQSHCL

ccccccccEEcccccEEEEEEEEcccccEEEEEEEcccccccccccHHHHHHHHHHccccccEEEEEEEEEccEEEEEEEcHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEcccccccccccccccccccEEccccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

cccEEEEEEEEcccccEEEEEEccccccEEEEEEEEHHHccccHHHHHHHHHHHHHcccccEccEEEEEEcccEEEEEEEcccccEHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccEEcccccHHHEEEccccEEEccccccEEcccccccccccccHHHcccHHHHcEcccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHHHcHHHccccccccccccHHHHcccccHHHHHHHHHHHcccccccccHHHHHccccHccccccccccccccccccccccccccccHcHccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MERYKILEElgdgtcgcvykafnveTYEIVAVKKMKRKFYFWEECMNLREVKALRklnhpniiKLKEVVRENNELFFIFEYMEHNLYHImrerqipfsegEIRSFMSQMLQGLAHMHrngyfhrdlkpenllvtnDVLKIADFGlarelssmppyteyvstrwyrapevllqsssyspaiDMWAVGAILAELftlspifpgdseiDQLYKVCCIlgapdwtafpeatnISRLISIsyseilpinlsdiipnasMEAIDLIWQLcswdplrrptadqalqhpffnvetwvpyplhdplelrlnnmgskpnlelnlwdfgtepddcflgltlavkpsnlemvhnvpqgmqedilfcsdlkdhseQTVFWSllspdqnrmrapvesslslsfssiqhpstgvpqsagyaitslqpnlldcpflavssplqqshcl

merykileelgdgtcgcvykafnveTYEIVAVKKMKRKFYFWEECMNLREVkalrklnhpniiklkevvRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNGYFHRDLKPENLLVTNDVLKIADFglarelssmppYTEYVSTRWYRAPEVLLQSSSYSPAIDMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEILPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHDPLELRLNNMGSKPNLELNLWDFGTEPDDCFLGLTLAVKPSNLEMVHNVPQGMQEDILFCSDLKDHSEQTVFWSLLSPDQNRMRAPVESSLSLSFSSIQHPSTGVPQSAGYAITSLQPNLLDCPFLAVssplqqshcl

****KILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHPNIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNGYFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAIDMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEILPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHDPLELRLNNMGSKPNLELNLWDFGTEPDDCFLGLTLAVKPSNLEMVHNVPQGMQEDILFCSDLKDHSEQTVFWSLL*********************************GYAITSLQPNLLDCPFLAV**********

*ERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHPNIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNGYFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAIDMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEILPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETW************************************************************************************************************************************************

*ERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHPNIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNGYFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAIDMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEILPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPL***************************PD*C************************************************************************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		432	2.2.26 [Sep-21-2011]
P43294		443	Serine/threonine-protein	yes	no	0.997	0.972	0.736	0.0
Q84SN3		433	Cyclin-dependent kinase F	yes	no	0.972	0.969	0.608	1e-149
Q6Z8C8		459	Cyclin-dependent kinase F	no	no	0.671	0.631	0.586	1e-106
Q04859		622	Serine/threonine-protein	yes	no	0.659	0.458	0.580	1e-102
P20793		622	Serine/threonine-protein	yes	no	0.659	0.458	0.583	1e-102
P20794		623	Serine/threonine-protein	yes	no	0.659	0.457	0.583	1e-102
Q9JKV2		629	Serine/threonine-protein	no	no	0.659	0.453	0.587	1e-101
Q62726		629	Serine/threonine-protein	no	no	0.659	0.453	0.587	1e-101
Q9UPZ9		632	Serine/threonine-protein	no	no	0.659	0.450	0.580	1e-100
Q55FJ6		507	Probable serine/threonine	yes	no	0.659	0.562	0.534	2e-91

>sp\|P43294\|MHK_ARATH Serine/threonine-protein kinase MHK OS=Arabidopsis thaliana GN=MHK PE=2 SV=2	Back alignment and function desciption

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/436 (73%), Positives = 381/436 (87%), Gaps = 5/436 (1%)

Query: 1   MERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHP 60
           M RYKILEELGDGTCG VYKA N+ETYE+VAVKKMKRKFY+WEEC+NLREVKALRKLNHP
Sbjct: 9   MCRYKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRKFYYWEECVNLREVKALRKLNHP 68

Query: 61  NIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNG 120
           +IIKLKE+VRE+NELFFIFE M+HNLYHIM+ER+ PFSEGEIRSFMSQMLQGLAHMH+NG
Sbjct: 69  HIIKLKEIVREHNELFFIFECMDHNLYHIMKERERPFSEGEIRSFMSQMLQGLAHMHKNG 128

Query: 121 YFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAI 180
           YFHRDLKPENLLVTN++LKIADFGLARE++SMPPYTEYVSTRWYRAPEVLLQSS Y+PA+
Sbjct: 129 YFHRDLKPENLLVTNNILKIADFGLAREVASMPPYTEYVSTRWYRAPEVLLQSSLYTPAV 188

Query: 181 DMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEI 240
           DMWAVGAILAEL+ L+P+FPG+SEIDQLYK+CC+LG PDWT FPEA +ISR++SIS++E 
Sbjct: 189 DMWAVGAILAELYALTPLFPGESEIDQLYKICCVLGKPDWTTFPEAKSISRIMSISHTEF 248

Query: 241 LPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHDPLELR 300
               ++D++PNA+ EAIDLI +LCSWDPL+RPTAD+AL HPFF++ T   YP+HD LELR
Sbjct: 249 PQTRIADLLPNAAPEAIDLINRLCSWDPLKRPTADEALNHPFFSMATQASYPIHD-LELR 307

Query: 301 LNNMGSKPNLELNLWDFGTEPDDCFLGLTLAVKPS--NLEMVHNVPQGMQEDILFCSDLK 358
           L+NM + PNLELNLWDF  EP++CFLGLTLAVKPS   LEM+ NV Q M E+ LFC  + 
Sbjct: 308 LDNMAALPNLELNLWDFNREPEECFLGLTLAVKPSAPKLEMLRNVSQDMSENFLFCPGVN 367

Query: 359 DHSEQTVFWSLLSPDQNRMRAPVE-SSLSLSFSSIQHPSTGVPQSAGYAIT-SLQPNLLD 416
           +  E +VFWSLLSPD+N + APVE S LSLSFS +Q  + G PQS+G+ +T S+QPN+LD
Sbjct: 368 NDREPSVFWSLLSPDENGLHAPVESSPLSLSFSPMQQHTVGPPQSSGFTMTSSMQPNMLD 427

Query: 417 CPFLAVSSPLQQSHCL 432
            P++AVS+P QQSH L
Sbjct: 428 RPWMAVSAPFQQSHYL 443

May play a role in the regulation of plant growth and development.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 2EC: 2

>sp\|Q84SN3\|CDKF3_ORYSJ Cyclin-dependent kinase F-3 OS=Oryza sativa subsp. japonica GN=CDKF-3 PE=2 SV=1	Back alignment and function description

>sp\|Q6Z8C8\|CDKF4_ORYSJ Cyclin-dependent kinase F-4 OS=Oryza sativa subsp. japonica GN=CDKF-4 PE=2 SV=1	Back alignment and function description

>sp\|Q04859\|MAK_MOUSE Serine/threonine-protein kinase MAK OS=Mus musculus GN=Mak PE=1 SV=2	Back alignment and function description

>sp\|P20793\|MAK_RAT Serine/threonine-protein kinase MAK OS=Rattus norvegicus GN=Mak PE=1 SV=2	Back alignment and function description

>sp\|P20794\|MAK_HUMAN Serine/threonine-protein kinase MAK OS=Homo sapiens GN=MAK PE=1 SV=2	Back alignment and function description

>sp\|Q9JKV2\|ICK_MOUSE Serine/threonine-protein kinase ICK OS=Mus musculus GN=Ick PE=2 SV=2	Back alignment and function description

>sp\|Q62726\|ICK_RAT Serine/threonine-protein kinase ICK OS=Rattus norvegicus GN=Ick PE=1 SV=1	Back alignment and function description

>sp\|Q9UPZ9\|ICK_HUMAN Serine/threonine-protein kinase ICK OS=Homo sapiens GN=ICK PE=1 SV=1	Back alignment and function description

>sp\|Q55FJ6\|Y8078_DICDI Probable serine/threonine-protein kinase DDB_G0268078 OS=Dictyostelium discoideum GN=DDB_G0268078 PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		432
255580503		433	mak, putative [Ricinus communis] gi\|2235	0.997	0.995	0.850	0.0
224065415		434	predicted protein [Populus trichocarpa]	1.0	0.995	0.822	0.0
30682312		435	serine/threonine-protein kinase MHK [Ara	0.997	0.990	0.738	0.0
296088149		447	unnamed protein product [Vitis vinifera]	0.905	0.874	0.791	0.0
15235551		443	serine/threonine-protein kinase MHK [Ara	0.997	0.972	0.736	0.0
79325075		444	serine/threonine-protein kinase MHK [Ara	0.997	0.970	0.720	0.0
297790790		447	predicted protein [Arabidopsis lyrata su	0.993	0.959	0.747	0.0
166811		443	protein kinase [Arabidopsis thaliana]	0.997	0.972	0.733	0.0
359494796		466	PREDICTED: serine/threonine-protein kina	0.900	0.834	0.790	0.0
334186479		444	serine/threonine-protein kinase MHK [Ara	0.997	0.970	0.723	0.0

>gi\|255580503\|ref\|XP_002531076.1\| mak, putative [Ricinus communis] gi\|223529322\|gb\|EEF31290.1\| mak, putative [Ricinus communis]	Back alignment and taxonomy information

 Score =  754 bits (1946), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/434 (85%), Positives = 402/434 (92%), Gaps = 3/434 (0%)

Query: 1   MERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHP 60
           MERYKIL ELGDGTCG V+KAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHP
Sbjct: 1   MERYKILGELGDGTCGNVFKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHP 60

Query: 61  NIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNG 120
           NIIKLKEVVRENNELFFIFEYME+NLY IMRER+ PF+E EIRSFMSQMLQGLAHMHRNG
Sbjct: 61  NIIKLKEVVRENNELFFIFEYMEYNLYQIMRERERPFTEEEIRSFMSQMLQGLAHMHRNG 120

Query: 121 YFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAI 180
           Y HRDLKPENLLVTNDVLKIADFGLARE+SS PPYTEYVSTRWYRAPEVLLQSS+Y+PAI
Sbjct: 121 YLHRDLKPENLLVTNDVLKIADFGLAREVSSAPPYTEYVSTRWYRAPEVLLQSSTYTPAI 180

Query: 181 DMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEI 240
           DMWAVG ILAELFTLSPIFPG+SEIDQLYK+CC+LG PDWT FP ATNISRL++I YSEI
Sbjct: 181 DMWAVGTILAELFTLSPIFPGESEIDQLYKICCVLGTPDWTTFPGATNISRLMNICYSEI 240

Query: 241 LPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHDPLELR 300
           LP NL DIIPNAS+EAIDLI +LCSWDPL+RPTA+QALQHPFF+V  WVPYP+ DPLEL+
Sbjct: 241 LPANLCDIIPNASLEAIDLIMRLCSWDPLKRPTAEQALQHPFFHVGMWVPYPIRDPLELK 300

Query: 301 LNNMGSKPNLELNLWDFGTEPDDCFLGLTLAVKP--SNLEMVHNVPQGMQEDILFCSDLK 358
           LN++G+KPNLELNLWDFG EPDDCFLGLTLAVKP  SNL+ VHNV QGM+E+ILFCSDLK
Sbjct: 301 LNSIGAKPNLELNLWDFGAEPDDCFLGLTLAVKPSISNLDAVHNVSQGMEENILFCSDLK 360

Query: 359 DHSEQTVFWSLLSPDQNRMRAPVESSLSLSFSSIQHPSTGVPQSAGYAITSLQPNLLDCP 418
           DH EQ+VFWSLLSPDQN +  PV+SSLSLSFSSIQHPS  VPQS+G+AITSLQPN+LDCP
Sbjct: 361 DHQEQSVFWSLLSPDQNGLHPPVQSSLSLSFSSIQHPSV-VPQSSGFAITSLQPNILDCP 419

Query: 419 FLAVSSPLQQSHCL 432
            L +SSP+QQSH L
Sbjct: 420 LLGMSSPIQQSHYL 433

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi\|224065415\|ref\|XP_002301806.1\| predicted protein [Populus trichocarpa] gi\|222843532\|gb\|EEE81079.1\| predicted protein [Populus trichocarpa]	Back alignment and taxonomy information

>gi\|30682312\|ref\|NP_849370.1\| serine/threonine-protein kinase MHK [Arabidopsis thaliana] gi\|13430824\|gb\|AAK26034.1\|AF360324_1 putative serine/threonine-specific protein kinase MHK [Arabidopsis thaliana] gi\|15810587\|gb\|AAL07181.1\| putative serine/threonine-specific protein kinase MHK [Arabidopsis thaliana] gi\|332657814\|gb\|AEE83214.1\| serine/threonine-protein kinase MHK [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|296088149\|emb\|CBI35594.3\| unnamed protein product [Vitis vinifera]	Back alignment and taxonomy information

>gi|15235551|ref|NP_193038.1| serine/threonine-protein kinase MHK [Arabidopsis thaliana] gi|21431785|sp|P43294.2|MHK_ARATH RecName: Full=Serine/threonine-protein kinase MHK gi|5123943|emb|CAB45501.1| serine/threonine-specific protein kinase MHK [Arabidopsis thaliana] gi|7268004|emb|CAB78344.1| serine/threonine-specific protein kinase MHK [Arabidopsis thaliana] gi|332657815|gb|AEE83215.1| serine/threonine-protein kinase MHK [Arabidopsis thaliana]

Back alignment and taxonomy information

>gi\|79325075\|ref\|NP_001031622.1\| serine/threonine-protein kinase MHK [Arabidopsis thaliana] gi\|332657816\|gb\|AEE83216.1\| serine/threonine-protein kinase MHK [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|297790790\|ref\|XP_002863280.1\| predicted protein [Arabidopsis lyrata subsp. lyrata] gi\|297309114\|gb\|EFH39539.1\| predicted protein [Arabidopsis lyrata subsp. lyrata]	Back alignment and taxonomy information

>gi\|166811\|gb\|AAA18854.1\| protein kinase [Arabidopsis thaliana]	Back alignment and taxonomy information

>gi\|359494796\|ref\|XP_002268075.2\| PREDICTED: serine/threonine-protein kinase MHK-like, partial [Vitis vinifera]	Back alignment and taxonomy information

>gi\|334186479\|ref\|NP_001190712.1\| serine/threonine-protein kinase MHK [Arabidopsis thaliana] gi\|332657818\|gb\|AEE83218.1\| serine/threonine-protein kinase MHK [Arabidopsis thaliana]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		432
TAIR\|locus:2123221		444	MHK [Arabidopsis thaliana (tax	0.997	0.970	0.718	1.1e-174
TAIR\|locus:2134746		464	AT4G19110 [Arabidopsis thalian	0.671	0.625	0.586	1.2e-97
TAIR\|locus:2163583		499	AT5G45430 [Arabidopsis thalian	0.687	0.595	0.569	3.7e-96
UNIPROTKB\|E2RE89		589	MAK "Uncharacterized protein"	0.717	0.526	0.556	4.2e-96
UNIPROTKB\|E2RP10		623	MAK "Uncharacterized protein"	0.717	0.497	0.556	4.2e-96
UNIPROTKB\|E1BWM1		625	MAK "Uncharacterized protein"	0.659	0.456	0.580	7.8e-95
UNIPROTKB\|F1RV90		624	MAK "Uncharacterized protein"	0.717	0.496	0.556	1.1e-94
UNIPROTKB\|E1BDG4		623	MAK "Uncharacterized protein"	0.659	0.457	0.587	6.1e-94
UNIPROTKB\|Q2YDJ7		382	MAK "Uncharacterized protein"	0.659	0.746	0.587	6.1e-94
UNIPROTKB\|P20794		623	MAK "Serine/threonine-protein	0.717	0.497	0.553	1e-93

TAIR\|locus:2123221 MHK [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

 Score = 1697 (602.4 bits), Expect = 1.1e-174, P = 1.1e-174
 Identities = 314/437 (71%), Positives = 374/437 (85%)

Query:     1 MERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLNHP 60
             M RYKILEELGDGTCG VYKA N+ETYE+VAVKKMKRKFY+WEEC+NLREVKALRKLNHP
Sbjct:     9 MCRYKILEELGDGTCGSVYKAVNLETYEVVAVKKMKRKFYYWEECVNLREVKALRKLNHP 68

Query:    61 NIIKLKEVVRENNELFFIFEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNG 120
             +IIKLKE+VRE+NELFFIFE M+HNLYHIM+ER+ PFSEGEIRSFMSQMLQGLAHMH+NG
Sbjct:    69 HIIKLKEIVREHNELFFIFECMDHNLYHIMKERERPFSEGEIRSFMSQMLQGLAHMHKNG 128

Query:   121 YFHRDLKPENLLVTNDVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAI 180
             YFHRDLKPENLLVTN++LKIADFGLARE++SMPPYTEYVSTRWYRAPEVLLQSS Y+PA+
Sbjct:   129 YFHRDLKPENLLVTNNILKIADFGLAREVASMPPYTEYVSTRWYRAPEVLLQSSLYTPAV 188

Query:   181 DMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEI 240
             DMWAVGAILAEL+ L+P+FPG+SEIDQLYK+CC+LG PDWT FPEA +ISR++SIS++E 
Sbjct:   189 DMWAVGAILAELYALTPLFPGESEIDQLYKICCVLGKPDWTTFPEAKSISRIMSISHTEF 248

Query:   241 LPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHDPLELR 300
                 ++D++PNA+ EAIDLI +LCSWDPL+RPTAD+AL HPFF++ T   YP+HD LELR
Sbjct:   249 PQTRIADLLPNAAPEAIDLINRLCSWDPLKRPTADEALNHPFFSMATQASYPIHD-LELR 307

Query:   301 LNNMGSKPNLELNLWDFGTEPDDCFLGLTLAVKPS--NLEMVHNVPQGMQEDILFCSDLK 358
             L+NM + PNLELNLWDF  EP++CFLGLTLAVKPS   LEM+ NV Q M E+ LFC  + 
Sbjct:   308 LDNMAALPNLELNLWDFNREPEECFLGLTLAVKPSAPKLEMLRNVSQDMSENFLFCPGVN 367

Query:   359 DHSEQTVFWSLLSPDQNRMRAPVEXX--XXXXXXXIQHPSTGVPQSAGYAITS-LQPNLL 415
             +  E +VFWSLLSPD+N + APVE           +Q  + G PQS+G+ +TS +QPN+L
Sbjct:   368 NDREPSVFWSLLSPDENGLHAPVESSPLSLSFSSPMQQHTVGPPQSSGFTMTSSMQPNML 427

Query:   416 DCPFLAVSSPLQQSHCL 432
             D P++AVS+P QQSH L
Sbjct:   428 DRPWMAVSAPFQQSHYL 444

GO:0004672 "protein kinase activity" evidence=IEA

GO:0004674 "protein serine/threonine kinase activity" evidence=IEA

GO:0004713 "protein tyrosine kinase activity" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0005634 "nucleus" evidence=ISM

GO:0006468 "protein phosphorylation" evidence=IEA

GO:0016301 "kinase activity" evidence=ISS

GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA

GO:0045727 "positive regulation of translation" evidence=RCA

TAIR\|locus:2134746 AT4G19110 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

TAIR\|locus:2163583 AT5G45430 [Arabidopsis thaliana (taxid:3702)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RE89 MAK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2RP10 MAK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BWM1 MAK "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RV90 MAK "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BDG4 MAK "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|Q2YDJ7 MAK "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P20794 MAK "Serine/threonine-protein kinase MAK" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q84SN3	CDKF3_ORYSJ	2, ., 7, ., 1, 1, ., 2, 3	0.6086	0.9722	0.9699	yes	no
P43294	MHK_ARATH	2, ., 7, ., 1, 1, ., 2, 2	0.7362	0.9976	0.9729	yes	no

EC Number Prediction by Ezypred Server

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	2.7.11.22	0.979
4th Layer	2.7.11.1	LOW CONFIDENCE prediction!
3rd Layer	2.7.11	0.983

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING

Original result from the STRING server

Your Input:
	estExt_Genewise1_v1.C_LG_II4024	hypothetical protein (435 aa)
		(Populus trichocarpa)
Predicted Functional Partners:
		Sorry, there are no predicted associations at the current settings.

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

ID	Alignment Graph	Length	Definition	E-value
Query		432
cd07830		283	cd07830, STKc_MAK_like, Catalytic domain of Male g	1e-177
cd05118		283	cd05118, STKc_CMGC, Catalytic domain of CMGC famil	1e-130
cd07829		282	cd07829, STKc_CDK_like, Catalytic domain of Cyclin	1e-118
cd07831		282	cd07831, STKc_MOK, Catalytic domain of the Serine/	1e-105
cd07840		287	cd07840, STKc_CDK9_like, Catalytic domain of Cycli	1e-104
cd07832		286	cd07832, STKc_CCRK, Catalytic domain of the Serine	1e-100
cd07841		298	cd07841, STKc_CDK7, Catalytic domain of the Serine	1e-98
smart00220		254	smart00220, S_TKc, Serine/Threonine protein kinase	2e-98
cd07834		330	cd07834, STKc_MAPK, Catalytic domain of the Serine	7e-97
pfam00069		260	pfam00069, Pkinase, Protein kinase domain	4e-92
cd07843		293	cd07843, STKc_CDC2L1, Catalytic domain of the Seri	5e-92
cd07833		288	cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep	8e-90
cd07835		283	cd07835, STKc_CDK1_like, Catalytic domain of Cycli	7e-85
cd07852		337	cd07852, STKc_MAPK15, Catalytic domain of the Seri	2e-82
cd07855		334	cd07855, STKc_ERK5, Catalytic domain of the Serine	6e-81
cd07866		311	cd07866, STKc_BUR1, Catalytic domain of the Serine	2e-78
cd07838		287	cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc	1e-77
cd07845		309	cd07845, STKc_CDK10, Catalytic domain of the Serin	5e-75
cd07860		284	cd07860, STKc_CDK2_3, Catalytic domain of the Seri	1e-74
cd07849		336	cd07849, STKc_ERK1_2_like, Catalytic domain of Ext	8e-74
cd07858		337	cd07858, STKc_TEY_MAPK_plant, Catalytic domain of	1e-73
cd07842		316	cd07842, STKc_CDK8_like, Catalytic domain of Cycli	4e-73
cd07857		332	cd07857, STKc_MPK1, Catalytic domain of the Serine	7e-73
PLN00009		294	PLN00009, PLN00009, cyclin-dependent kinase A; Pro	1e-72
cd07836		284	cd07836, STKc_Pho85, Catalytic domain of the Serin	3e-72
cd07837		295	cd07837, STKc_CdkB_plant, Catalytic domain of the	4e-72
cd07865		310	cd07865, STKc_CDK9, Catalytic domain of the Serine	2e-71
cd07864		302	cd07864, STKc_CDK12, Catalytic domain of the Serin	5e-70
PTZ00024		335	PTZ00024, PTZ00024, cyclin-dependent protein kinas	6e-70
cd07851		343	cd07851, STKc_p38, Catalytic domain of the Serine/	1e-69
cd07861		285	cd07861, STKc_CDK1_euk, Catalytic domain of the Se	3e-69
cd07847		286	cd07847, STKc_CDKL1_4, Catalytic domain of the Ser	1e-67
cd07846		286	cd07846, STKc_CDKL2_3, Catalytic domain of the Ser	3e-67
cd07839		284	cd07839, STKc_CDK5, Catalytic domain of the Serine	4e-66
cd07859		338	cd07859, STKc_TDY_MAPK_plant, Catalytic domain of	8e-66
cd00180		215	cd00180, PKc, Catalytic domain of Protein Kinases	9e-63
cd07844		291	cd07844, STKc_PCTAIRE_like, Catalytic domain of PC	4e-62
cd07848		287	cd07848, STKc_CDKL5, Catalytic domain of the Serin	5e-60
cd07871		288	cd07871, STKc_PCTAIRE3, Catalytic domain of the Se	2e-58
cd07872		309	cd07872, STKc_PCTAIRE2, Catalytic domain of the Se	2e-57
cd06606		260	cd06606, STKc_MAPKKK, Catalytic domain of the Prot	1e-56
cd07863		288	cd07863, STKc_CDK4, Catalytic domain of the Serine	2e-56
cd07879		342	cd07879, STKc_p38delta_MAPK13, Catalytic domain of	4e-56
cd07873		301	cd07873, STKc_PCTAIRE1, Catalytic domain of the Se	5e-56
cd07854		342	cd07854, STKc_MAPK4_6, Catalytic domain of the Ser	7e-55
cd07856		328	cd07856, STKc_Sty1_Hog1, Catalytic domain of the S	1e-53
cd07880		343	cd07880, STKc_p38gamma_MAPK12, Catalytic domain of	8e-53
cd07850		353	cd07850, STKc_JNK, Catalytic domain of the Serine/	8e-53
cd08215		258	cd08215, STKc_Nek, Catalytic domain of the Protein	3e-51
cd07878		343	cd07878, STKc_p38beta_MAPK11, Catalytic domain of	2e-50
cd07877		345	cd07877, STKc_p38alpha_MAPK14, Catalytic domain of	2e-49
COG0515		384	COG0515, SPS1, Serine/threonine protein kinase [Ge	2e-49
cd07870		291	cd07870, STKc_PFTAIRE2, Catalytic domain of the Se	4e-49
cd07862		290	cd07862, STKc_CDK6, Catalytic domain of the Serine	2e-48
cd05122		253	cd05122, PKc_STE, Catalytic domain of STE family P	4e-48
cd06627		254	cd06627, STKc_Cdc7_like, Catalytic domain of Cell	4e-46
cd07853		372	cd07853, STKc_NLK, Catalytic domain of the Serine/	5e-45
cd05123		250	cd05123, STKc_AGC, Catalytic domain of AGC family	2e-44
cd07874		355	cd07874, STKc_JNK3, Catalytic domain of the Serine	3e-43
cd07869		303	cd07869, STKc_PFTAIRE1, Catalytic domain of the Se	3e-43
cd07876		359	cd07876, STKc_JNK2, Catalytic domain of the Serine	3e-43
cd07868		317	cd07868, STKc_CDK8, Catalytic domain of the Serine	5e-43
cd07875		364	cd07875, STKc_JNK1, Catalytic domain of the Serine	6e-43
PTZ00036		440	PTZ00036, PTZ00036, glycogen synthase kinase; Prov	6e-43
cd05581		280	cd05581, STKc_PDK1, Catalytic domain of the Protei	8e-42
cd07867		317	cd07867, STKc_CDC2L6, Catalytic domain of Serine/T	1e-40
smart00219		257	smart00219, TyrKc, Tyrosine kinase, catalytic doma	3e-40
cd06632		258	cd06632, STKc_MEKK1_plant, Catalytic domain of the	5e-40
pfam07714		258	pfam07714, Pkinase_Tyr, Protein tyrosine kinase	2e-39
smart00221		258	smart00221, STYKc, Protein kinase; unclassified sp	5e-39
cd08217		265	cd08217, STKc_Nek2, Catalytic domain of the Protei	1e-37
cd06614		286	cd06614, STKc_PAK, Catalytic domain of the Protein	2e-37
cd08530		256	cd08530, STKc_CNK2-like, Catalytic domain of the P	2e-36
cd06623		264	cd06623, PKc_MAPKK_plant_like, Catalytic domain of	7e-36
cd06629		272	cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o	3e-35
cd06613		262	cd06613, STKc_MAP4K3_like, Catalytic domain of Mit	4e-35
cd06626		264	cd06626, STKc_MEKK4, Catalytic domain of the Prote	5e-35
cd00192		262	cd00192, PTKc, Catalytic domain of Protein Tyrosin	1e-34
cd06612		256	cd06612, STKc_MST1_2, Catalytic domain of the Prot	8e-34
cd05579		265	cd05579, STKc_MAST_like, Catalytic domain of Micro	5e-33
cd06610		267	cd06610, STKc_OSR1_SPAK, Catalytic domain of the P	5e-33
cd08221		256	cd08221, STKc_Nek9, Catalytic domain of the Protei	9e-33
cd05572		262	cd05572, STKc_cGK_PKG, Catalytic domain of the Pro	5e-32
cd08225		257	cd08225, STKc_Nek5, Catalytic domain of the Protei	3e-31
cd06607		307	cd06607, STKc_TAO, Catalytic domain of the Protein	1e-30
cd08224		267	cd08224, STKc_Nek6_Nek7, Catalytic domain of the P	2e-30
cd06628		267	cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o	3e-30
cd06611		280	cd06611, STKc_SLK_like, Catalytic domain of Ste20-	1e-29
cd08220		256	cd08220, STKc_Nek8, Catalytic domain of the Protei	1e-28
cd06633		313	cd06633, STKc_TAO3, Catalytic domain of the Protei	1e-28
cd06609		274	cd06609, STKc_MST3_like, Catalytic domain of Mamma	2e-28
cd08529		256	cd08529, STKc_FA2-like, Catalytic domain of the Pr	8e-28
cd05578		258	cd05578, STKc_Yank1, Catalytic domain of the Prote	2e-27
cd08218		256	cd08218, STKc_Nek1, Catalytic domain of the Protei	2e-27
cd06605		265	cd06605, PKc_MAPKK, Catalytic domain of the dual-s	3e-27
cd06634		308	cd06634, STKc_TAO2, Catalytic domain of the Protei	4e-27
cd06630		268	cd06630, STKc_MEKK1, Catalytic domain of the Prote	5e-27
cd06645		267	cd06645, STKc_MAP4K3, Catalytic domain of the Prot	9e-27
cd06635		317	cd06635, STKc_TAO1, Catalytic domain of the Protei	1e-26
cd05600		333	cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun	2e-26
cd06608		275	cd06608, STKc_myosinIII_like, Catalytic domain of	2e-26
cd06624		268	cd06624, STKc_ASK, Catalytic domain of the Protein	2e-26
cd05059		256	cd05059, PTKc_Tec_like, Catalytic domain of Tec-li	7e-26
cd05033		266	cd05033, PTKc_EphR, Catalytic domain of Ephrin Rec	1e-25
cd08528		269	cd08528, STKc_Nek10, Catalytic domain of the Prote	1e-25
cd06644		292	cd06644, STKc_STK10_LOK, Catalytic domain of the P	2e-25
cd05580		290	cd05580, STKc_PKA, Catalytic domain of the Protein	6e-25
cd06643		282	cd06643, STKc_SLK, Catalytic domain of the Protein	1e-24
cd08219		255	cd08219, STKc_Nek3, Catalytic domain of the Protei	3e-24
cd06656		297	cd06656, STKc_PAK3, Catalytic domain of the Protei	3e-24
cd06647		293	cd06647, STKc_PAK_I, Catalytic domain of the Prote	4e-24
cd06654		296	cd06654, STKc_PAK1, Catalytic domain of the Protei	1e-23
cd06646		267	cd06646, STKc_MAP4K5, Catalytic domain of the Prot	1e-23
cd06648		285	cd06648, STKc_PAK_II, Catalytic domain of the Prot	1e-23
cd05038		284	cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai	2e-23
cd08229		267	cd08229, STKc_Nek7, Catalytic domain of the Protei	3e-23
cd05570		318	cd05570, STKc_PKC, Catalytic domain of the Protein	5e-23
cd05112		256	cd05112, PTKc_Itk, Catalytic domain of the Protein	5e-23
cd05577		277	cd05577, STKc_GRK, Catalytic domain of the Protein	7e-23
cd06917		277	cd06917, STKc_NAK1_like, Catalytic domain of Funga	8e-23
PLN00034		353	PLN00034, PLN00034, mitogen-activated protein kina	2e-22
cd05591		321	cd05591, STKc_nPKC_epsilon, Catalytic domain of th	3e-22
cd05034		261	cd05034, PTKc_Src_like, Catalytic domain of Src ki	5e-22
cd06625		263	cd06625, STKc_MEKK3_like, Catalytic domain of MAP/	9e-22
cd08222		260	cd08222, STKc_Nek11, Catalytic domain of the Prote	1e-21
cd05586		330	cd05586, STKc_Sck1_like, Catalytic domain of Suppr	1e-21
cd05080		283	cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma	1e-21
cd08228		267	cd08228, STKc_Nek6, Catalytic domain of the Protei	1e-21
cd05048		283	cd05048, PTKc_Ror, Catalytic Domain of the Protein	2e-21
cd06659		297	cd06659, STKc_PAK6, Catalytic domain of the Protei	3e-21
cd05571		323	cd05571, STKc_PKB, Catalytic domain of the Protein	4e-21
cd06655		296	cd06655, STKc_PAK2, Catalytic domain of the Protei	4e-21
cd05114		256	cd05114, PTKc_Tec_Rlk, Catalytic domain of the Pro	4e-21
cd05612		291	cd05612, STKc_PRKX_like, Catalytic domain of PRKX-	5e-21
cd05611		260	cd05611, STKc_Rim15_like, Catalytic domain of fung	1e-20
cd05589		324	cd05589, STKc_PKN, Catalytic domain of the Protein	1e-20
cd05573		350	cd05573, STKc_ROCK_NDR_like, Catalytic domain of R	1e-20
TIGR03903		1266	TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas	2e-20
cd05585		312	cd05585, STKc_YPK1_like, Catalytic domain of Yeast	2e-20
cd06631		265	cd06631, STKc_YSK4, Catalytic domain of the Protei	3e-20
cd05052		263	cd05052, PTKc_Abl, Catalytic domain of the Protein	4e-20
cd05081		284	cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2)	7e-20
cd06621		287	cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of	1e-19
cd05049		280	cd05049, PTKc_Trk, Catalytic domain of the Protein	3e-19
cd05583		288	cd05583, STKc_MSK_N, N-terminal catalytic domain o	4e-19
cd05590		320	cd05590, STKc_nPKC_eta, Catalytic domain of the Pr	4e-19
cd05593		328	cd05593, STKc_PKB_gamma, Catalytic domain of the P	5e-19
cd05041		251	cd05041, PTKc_Fes_like, Catalytic domain of Fes-li	8e-19
PHA03209		357	PHA03209, PHA03209, serine/threonine kinase US3; P	8e-19
cd05148		261	cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro	8e-19
cd05601		330	cd05601, STKc_CRIK, Catalytic domain of the Protei	1e-18
cd05113		256	cd05113, PTKc_Btk_Bmx, Catalytic domain of the Pro	3e-18
cd05050		288	cd05050, PTKc_Musk, Catalytic domain of the Protei	3e-18
cd05599		364	cd05599, STKc_NDR_like, Catalytic domain of Nuclea	3e-18
cd05584		323	cd05584, STKc_p70S6K, Catalytic domain of the Prot	4e-18
cd05053		293	cd05053, PTKc_FGFR, Catalytic domain of the Protei	5e-18
cd05032		277	cd05032, PTKc_InsR_like, Catalytic domain of Insul	5e-18
cd05595		323	cd05595, STKc_PKB_beta, Catalytic domain of the Pr	6e-18
cd05574		316	cd05574, STKc_phototropin_like, Catalytic domain o	6e-18
cd05592		316	cd05592, STKc_nPKC_theta_delta, Catalytic domain o	6e-18
cd05044		269	cd05044, PTKc_c-ros, Catalytic domain of the Prote	6e-18
cd06658		292	cd06658, STKc_PAK5, Catalytic domain of the Protei	8e-18
cd06640		277	cd06640, STKc_MST4, Catalytic domain of the Protei	8e-18
PTZ00263		329	PTZ00263, PTZ00263, protein kinase A catalytic sub	1e-17
cd06657		292	cd06657, STKc_PAK4, Catalytic domain of the Protei	1e-17
cd05072		261	cd05072, PTKc_Lyn, Catalytic domain of the Protein	1e-17
cd05068		261	cd05068, PTKc_Frk_like, Catalytic domain of Fyn-re	1e-17
cd05079		284	cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma	1e-17
cd05045		290	cd05045, PTKc_RET, Catalytic domain of the Protein	2e-17
cd05575		323	cd05575, STKc_SGK, Catalytic domain of the Protein	3e-17
cd05603		321	cd05603, STKc_SGK2, Catalytic domain of the Protei	3e-17
cd05622		371	cd05622, STKc_ROCK1, Catalytic domain of the Prote	4e-17
cd05604		325	cd05604, STKc_SGK3, Catalytic domain of the Protei	5e-17
cd05066		267	cd05066, PTKc_EphR_A, Catalytic domain of the Prot	5e-17
cd05632		285	cd05632, STKc_GRK5, Catalytic domain of the Protei	7e-17
cd06641		277	cd06641, STKc_MST3, Catalytic domain of the Protei	7e-17
cd05607		277	cd05607, STKc_GRK7, Catalytic domain of the Protei	7e-17
PTZ00267		478	PTZ00267, PTZ00267, NIMA-related protein kinase; P	7e-17
cd05040		257	cd05040, PTKc_Ack_like, Catalytic domain of the Pr	8e-17
cd05605		285	cd05605, STKc_GRK4_like, Catalytic domain of G pro	8e-17
cd05065		269	cd05065, PTKc_EphR_B, Catalytic domain of the Prot	8e-17
cd05598		376	cd05598, STKc_LATS, Catalytic domain of the Protei	9e-17
cd05596		370	cd05596, STKc_ROCK, Catalytic domain of the Protei	1e-16
cd05067		260	cd05067, PTKc_Lck_Blk, Catalytic domain of the Pro	1e-16
cd05633		279	cd05633, STKc_GRK3, Catalytic domain of the Protei	1e-16
PTZ00266		1021	PTZ00266, PTZ00266, NIMA-related protein kinase; P	2e-16
cd05606		278	cd05606, STKc_beta_ARK, Catalytic domain of the Pr	2e-16
cd05582		318	cd05582, STKc_RSK_N, N-terminal catalytic domain o	2e-16
cd05097		295	cd05097, PTKc_DDR_like, Catalytic domain of Discoi	2e-16
cd05594		325	cd05594, STKc_PKB_alpha, Catalytic domain of the P	3e-16
cd05085		250	cd05085, PTKc_Fer, Catalytic domain of the Protein	3e-16
cd05630		285	cd05630, STKc_GRK6, Catalytic domain of the Protei	3e-16
cd05613		290	cd05613, STKc_MSK1_N, N-terminal catalytic domain	4e-16
cd05615		323	cd05615, STKc_cPKC_alpha, Catalytic domain of the	4e-16
cd06642		277	cd06642, STKc_STK25-YSK1, Catalytic domain of the	4e-16
cd05587		324	cd05587, STKc_cPKC, Catalytic domain of the Protei	6e-16
cd05602		325	cd05602, STKc_SGK1, Catalytic domain of the Protei	6e-16
cd05608		280	cd05608, STKc_GRK1, Catalytic domain of the Protei	7e-16
cd08223		257	cd08223, STKc_Nek4, Catalytic domain of the Protei	7e-16
cd05039		256	cd05039, PTKc_Csk_like, Catalytic domain of C-term	1e-15
cd05095		296	cd05095, PTKc_DDR2, Catalytic domain of the Protei	1e-15
cd05614		332	cd05614, STKc_MSK2_N, N-terminal catalytic domain	1e-15
cd05063		268	cd05063, PTKc_EphR_A2, Catalytic domain of the Pro	1e-15
cd05621		370	cd05621, STKc_ROCK2, Catalytic domain of the Prote	2e-15
cd05618		329	cd05618, STKc_aPKC_iota, Catalytic domain of the P	2e-15
cd06619		279	cd06619, PKc_MKK5, Catalytic domain of the dual-sp	2e-15
cd05619		316	cd05619, STKc_nPKC_theta, Catalytic domain of the	2e-15
cd06653		264	cd06653, STKc_MEKK3_like_1, Catalytic domain of MA	2e-15
cd06618		296	cd06618, PKc_MKK7, Catalytic domain of the dual-sp	2e-15
cd05055		302	cd05055, PTKc_PDGFR, Catalytic domain of the Prote	3e-15
cd05094		291	cd05094, PTKc_TrkC, Catalytic domain of the Protei	3e-15
PHA03210		501	PHA03210, PHA03210, serine/threonine kinase US3; P	3e-15
cd05082		256	cd05082, PTKc_Csk, Catalytic domain of the Protein	5e-15
cd05620		316	cd05620, STKc_nPKC_delta, Catalytic domain of the	5e-15
cd05101		304	cd05101, PTKc_FGFR2, Catalytic domain of the Prote	5e-15
cd05093		288	cd05093, PTKc_TrkB, Catalytic domain of the Protei	5e-15
PHA03212		391	PHA03212, PHA03212, serine/threonine kinase US3; P	6e-15
cd05083		254	cd05083, PTKc_Chk, Catalytic domain of the Protein	7e-15
cd08216		314	cd08216, PK_STRAD, Pseudokinase domain of STE20-re	7e-15
cd05073		260	cd05073, PTKc_Hck, Catalytic domain of the Protein	9e-15
cd05098		307	cd05098, PTKc_FGFR1, Catalytic domain of the Prote	9e-15
cd06638		286	cd06638, STKc_myosinIIIA, Catalytic domain of the	1e-14
cd05070		260	cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Pro	1e-14
cd05100		334	cd05100, PTKc_FGFR3, Catalytic domain of the Prote	1e-14
cd05092		280	cd05092, PTKc_TrkA, Catalytic domain of the Protei	1e-14
cd05099		314	cd05099, PTKc_FGFR4, Catalytic domain of the Prote	2e-14
cd06649		331	cd06649, PKc_MEK2, Catalytic domain of the dual-sp	3e-14
cd06615		308	cd06615, PKc_MEK, Catalytic domain of the dual-spe	3e-14
PHA03211		461	PHA03211, PHA03211, serine/threonine kinase US3; P	3e-14
cd06651		266	cd06651, STKc_MEKK3, Catalytic domain of the Prote	4e-14
cd06652		265	cd06652, STKc_MEKK2, Catalytic domain of the Prote	4e-14
cd06622		286	cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of	5e-14
cd06636		282	cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr	5e-14
cd05069		260	cd05069, PTKc_Yes, Catalytic domain of the Protein	6e-14
cd05616		323	cd05616, STKc_cPKC_beta, Catalytic domain of the P	6e-14
cd05071		262	cd05071, PTKc_Src, Catalytic domain of the Protein	6e-14
cd05090		283	cd05090, PTKc_Ror1, Catalytic domain of the Protei	7e-14
cd05084		252	cd05084, PTKc_Fes, Catalytic domain of the Protein	1e-13
cd05631		285	cd05631, STKc_GRK4, Catalytic domain of the Protei	1e-13
cd05116		257	cd05116, PTKc_Syk, Catalytic domain of the Protein	1e-13
cd06637		272	cd06637, STKc_TNIK, Catalytic domain of the Protei	1e-13
cd05061		288	cd05061, PTKc_InsR, Catalytic domain of the Protei	1e-13
PHA03207		392	PHA03207, PHA03207, serine/threonine kinase US3; P	1e-13
PTZ00283		496	PTZ00283, PTZ00283, serine/threonine protein kinas	1e-13
PRK13184		932	PRK13184, pknD, serine/threonine-protein kinase; R	2e-13
cd05625		382	cd05625, STKc_LATS1, Catalytic domain of the Prote	3e-13
cd05060		257	cd05060, PTKc_Syk_like, Catalytic domain of Spleen	4e-13
cd05051		296	cd05051, PTKc_DDR, Catalytic domain of the Protein	4e-13
cd06617		283	cd06617, PKc_MKK3_6, Catalytic domain of the dual-	4e-13
cd05042		269	cd05042, PTKc_Aatyk, Catalytic domain of the Prote	5e-13
cd05626		381	cd05626, STKc_LATS2, Catalytic domain of the Prote	6e-13
cd05588		329	cd05588, STKc_aPKC, Catalytic domain of the Protei	6e-13
cd06639		291	cd06639, STKc_myosinIIIB, Catalytic domain of the	6e-13
cd05064		266	cd05064, PTKc_EphR_A10, Catalytic domain of the Pr	2e-12
cd06650		333	cd06650, PKc_MEK1, Catalytic domain of the dual-sp	2e-12
cd05617		327	cd05617, STKc_aPKC_zeta, Catalytic domain of the P	2e-12
cd05062		277	cd05062, PTKc_IGF-1R, Catalytic domain of the Prot	2e-12
cd05609		305	cd05609, STKc_MAST, Catalytic domain of the Protei	3e-12
PTZ00426		340	PTZ00426, PTZ00426, cAMP-dependent protein kinase	3e-12
cd05115		257	cd05115, PTKc_Zap-70, Catalytic domain of the Prot	8e-12
cd05046		275	cd05046, PTK_CCK4, Pseudokinase domain of the Prot	1e-11
cd05096		304	cd05096, PTKc_DDR1, Catalytic domain of the Protei	1e-11
PTZ00284		467	PTZ00284, PTZ00284, protein kinase; Provisional	2e-11
cd05057		279	cd05057, PTKc_EGFR_like, Catalytic domain of Epide	2e-11
cd05058		262	cd05058, PTKc_Met_Ron, Catalytic domain of the Pro	3e-11
cd06620		284	cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of	3e-11
cd05102		338	cd05102, PTKc_VEGFR3, Catalytic domain of the Prot	5e-11
cd05091		283	cd05091, PTKc_Ror2, Catalytic domain of the Protei	5e-11
cd05054		337	cd05054, PTKc_VEGFR, Catalytic domain of the Prote	6e-11
cd05597		331	cd05597, STKc_DMPK_like, Catalytic domain of Myoto	9e-11
cd05088		303	cd05088, PTKc_Tie2, Catalytic domain of the Protei	1e-10
cd05103		343	cd05103, PTKc_VEGFR2, Catalytic domain of the Prot	2e-10
cd05036		277	cd05036, PTKc_ALK_LTK, Catalytic domain of the Pro	2e-10
cd05043		280	cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Rece	3e-10
cd05089		297	cd05089, PTKc_Tie1, Catalytic domain of the Protei	3e-10
cd05627		360	cd05627, STKc_NDR2, Catalytic domain of the Protei	3e-10
cd05074		273	cd05074, PTKc_Tyro3, Catalytic domain of the Prote	3e-10
cd05056		270	cd05056, PTKc_FAK, Catalytic domain of the Protein	3e-10
cd05629		377	cd05629, STKc_NDR_like_fungal, Catalytic domain of	7e-10
cd05047		270	cd05047, PTKc_Tie, Catalytic domain of Tie Protein	8e-10
cd05087		269	cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of t	9e-10
cd06616		288	cd06616, PKc_MKK4, Catalytic domain of the dual-sp	9e-10
cd05035		273	cd05035, PTKc_Axl_like, Catalytic Domain of Axl-li	9e-10
cd05075		272	cd05075, PTKc_Axl, Catalytic domain of the Protein	1e-09
PHA03390		267	PHA03390, pk1, serine/threonine-protein kinase 1;	1e-09
PLN03224		507	PLN03224, PLN03224, probable serine/threonine prot	2e-09
cd05623		332	cd05623, STKc_MRCK_alpha, Catalytic domain of the	2e-09
cd05576		237	cd05576, STKc_RPK118_like, Catalytic domain of the	2e-09
cd05104		375	cd05104, PTKc_Kit, Catalytic domain of the Protein	3e-09
cd05086		268	cd05086, PTKc_Aatyk2, Catalytic domain of the Prot	3e-09
cd05106		374	cd05106, PTKc_CSF-1R, Catalytic domain of the Prot	3e-09
cd05610		669	cd05610, STKc_MASTL, Catalytic domain of the Prote	9e-09
cd05624		331	cd05624, STKc_MRCK_beta, Catalytic domain of the P	1e-08
cd08226		328	cd08226, PK_STRAD_beta, Pseudokinase domain of STE	3e-08
cd05628		363	cd05628, STKc_NDR1, Catalytic domain of the Protei	3e-08
cd05105		400	cd05105, PTKc_PDGFR_alpha, Catalytic domain of the	1e-07
PLN03225		566	PLN03225, PLN03225, Serine/threonine-protein kinas	5e-07
cd05107		401	cd05107, PTKc_PDGFR_beta, Catalytic domain of the	8e-07
cd05108		316	cd05108, PTKc_EGFR, Catalytic domain of the Protei	1e-05
cd08227		327	cd08227, PK_STRAD_alpha, Pseudokinase domain of ST	1e-05
cd05110		303	cd05110, PTKc_HER4, Catalytic domain of the Protei	2e-05
cd05111		279	cd05111, PTK_HER3, Pseudokinase domain of the Prot	3e-05
COG3642		204	COG3642, COG3642, Mn2+-dependent serine/threonine	7e-05
cd05109		279	cd05109, PTKc_HER2, Catalytic domain of the Protei	1e-04
PLN00113		968	PLN00113, PLN00113, leucine-rich repeat receptor-l	1e-04
PHA02988		283	PHA02988, PHA02988, hypothetical protein; Provisio	2e-04
cd05610		669	cd05610, STKc_MASTL, Catalytic domain of the Prote	3e-04
TIGR03724		199	TIGR03724, arch_bud32, Kae1-associated kinase Bud3	3e-04
PRK09605		535	PRK09605, PRK09605, bifunctional UGMP family prote	4e-04
PHA02882		294	PHA02882, PHA02882, putative serine/threonine kina	7e-04
PRK14879		211	PRK14879, PRK14879, serine/threonine protein kinas	0.001
COG1718		268	COG1718, RIO1, Serine/threonine protein kinase inv	0.001
smart00750		176	smart00750, KIND, kinase non-catalytic C-lobe doma	0.002

>gnl\|CDD\|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

 Score =  494 bits (1275), Expect = e-177
 Identities = 181/283 (63%), Positives = 230/283 (81%), Gaps = 3/283 (1%)

Query: 4   YKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLN-HPNI 62
           YK++++LGDGT G VY A N ET E+VA+KKMK+KFY WEECMNLREVK+LRKLN HPNI
Sbjct: 1   YKVIKQLGDGTFGSVYLARNKETGELVAIKKMKKKFYSWEECMNLREVKSLRKLNEHPNI 60

Query: 63  IKLKEVVRENNELFFIFEYMEHNLYHIMRERQ-IPFSEGEIRSFMSQMLQGLAHMHRNGY 121
           +KLKEV REN+EL+F+FEYME NLY +M++R+  PFSE  IRS + Q+LQGLAH+H++G+
Sbjct: 61  VKLKEVFRENDELYFVFEYMEGNLYQLMKDRKGKPFSESVIRSIIYQILQGLAHIHKHGF 120

Query: 122 FHRDLKPENLLVTN-DVLKIADFGLARELSSMPPYTEYVSTRWYRAPEVLLQSSSYSPAI 180
           FHRDLKPENLLV+  +V+KIADFGLARE+ S PPYT+YVSTRWYRAPE+LL+S+SYS  +
Sbjct: 121 FHRDLKPENLLVSGPEVVKIADFGLAREIRSRPPYTDYVSTRWYRAPEILLRSTSYSSPV 180

Query: 181 DMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISYSEI 240
           D+WA+G I+AEL+TL P+FPG SEIDQLYK+C +LG P    +PE   ++  +   + + 
Sbjct: 181 DIWALGCIMAELYTLRPLFPGSSEIDQLYKICSVLGTPTKQDWPEGYKLASKLGFRFPQF 240

Query: 241 LPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFF 283
            P +L  +IPNAS EAIDLI  +  WDP +RPTA QALQHP+F
Sbjct: 241 APTSLHQLIPNASPEAIDLIKDMLRWDPKKRPTASQALQHPYF 283

Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertility. It functions as a coactivator of the androgen receptor in prostate cells. MRK, also called Intestinal Cell Kinase (ICK), is expressed ubiquitously, with highest expression in the ovary and uterus. A missense mutation in MRK causes endocrine-cerebro-osteodysplasia (ECO), suggesting that this protein plays an important role in the development of many organs. MAK and MRK may be involved in regulating cell cycle and cell fate. Ime2p is a meiosis-specific kinase that is important during meiotic initiation and during the later stages of meiosis. Mde3 functions downstream of the transcription factor Mei-4 which is essential for meiotic prophase I. Length = 283

>gnl\|CDD\|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>gnl\|CDD\|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>gnl\|CDD\|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>gnl\|CDD\|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>gnl\|CDD\|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|215690 pfam00069, Pkinase, Protein kinase domain	Back alignment and domain information

>gnl\|CDD\|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>gnl\|CDD\|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>gnl\|CDD\|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5	Back alignment and domain information

>gnl\|CDD\|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>gnl\|CDD\|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>gnl\|CDD\|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>gnl\|CDD\|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>gnl\|CDD\|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1	Back alignment and domain information

>gnl\|CDD\|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional	Back alignment and domain information

>gnl\|CDD\|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>gnl\|CDD\|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>gnl\|CDD\|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>gnl\|CDD\|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>gnl\|CDD\|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like	Back alignment and domain information

>gnl\|CDD\|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>gnl\|CDD\|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>gnl\|CDD\|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>gnl\|CDD\|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>gnl\|CDD\|173623 cd00180, PKc, Catalytic domain of Protein Kinases	Back alignment and domain information

>gnl\|CDD\|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>gnl\|CDD\|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>gnl\|CDD\|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>gnl\|CDD\|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>gnl\|CDD\|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>gnl\|CDD\|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6	Back alignment and domain information

>gnl\|CDD\|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1	Back alignment and domain information

>gnl\|CDD\|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase	Back alignment and domain information

>gnl\|CDD\|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>gnl\|CDD\|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase	Back alignment and domain information

>gnl\|CDD\|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>gnl\|CDD\|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase	Back alignment and domain information

>gnl\|CDD\|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>gnl\|CDD\|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>gnl\|CDD\|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase	Back alignment and domain information

>gnl\|CDD\|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>gnl\|CDD\|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase	Back alignment and domain information

>gnl\|CDD\|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2	Back alignment and domain information

>gnl\|CDD\|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8	Back alignment and domain information

>gnl\|CDD\|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1	Back alignment and domain information

>gnl\|CDD\|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>gnl\|CDD\|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>gnl\|CDD\|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain	Back alignment and domain information

>gnl\|CDD\|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase	Back alignment and domain information

>gnl\|CDD\|214568 smart00221, STYKc, Protein kinase; unclassified specificity	Back alignment and domain information

>gnl\|CDD\|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>gnl\|CDD\|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>gnl\|CDD\|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>gnl\|CDD\|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>gnl\|CDD\|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>gnl\|CDD\|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>gnl\|CDD\|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>gnl\|CDD\|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>gnl\|CDD\|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>gnl\|CDD\|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins	Back alignment and domain information

>gnl\|CDD\|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>gnl\|CDD\|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>gnl\|CDD\|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>gnl\|CDD\|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3	Back alignment and domain information

>gnl\|CDD\|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>gnl\|CDD\|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>gnl\|CDD\|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>gnl\|CDD\|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>gnl\|CDD\|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2	Back alignment and domain information

>gnl\|CDD\|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>gnl\|CDD\|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3	Back alignment and domain information

>gnl\|CDD\|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1	Back alignment and domain information

>gnl\|CDD\|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>gnl\|CDD\|173637 cd05059, PTKc_Tec_like, Catalytic domain of Tec-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|133165 cd05033, PTKc_EphR, Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>gnl\|CDD\|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>gnl\|CDD\|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>gnl\|CDD\|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>gnl\|CDD\|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>gnl\|CDD\|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>gnl\|CDD\|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>gnl\|CDD\|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5	Back alignment and domain information

>gnl\|CDD\|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>gnl\|CDD\|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>gnl\|CDD\|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>gnl\|CDD\|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|133243 cd05112, PTKc_Itk, Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase	Back alignment and domain information

>gnl\|CDD\|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase	Back alignment and domain information

>gnl\|CDD\|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon	Back alignment and domain information

>gnl\|CDD\|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>gnl\|CDD\|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>gnl\|CDD\|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6	Back alignment and domain information

>gnl\|CDD\|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors	Back alignment and domain information

>gnl\|CDD\|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>gnl\|CDD\|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>gnl\|CDD\|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>gnl\|CDD\|173658 cd05114, PTKc_Tec_Rlk, Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase	Back alignment and domain information

>gnl\|CDD\|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>gnl\|CDD\|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein	Back alignment and domain information

>gnl\|CDD\|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>gnl\|CDD\|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase	Back alignment and domain information

>gnl\|CDD\|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>gnl\|CDD\|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases	Back alignment and domain information

>gnl\|CDD\|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>gnl\|CDD\|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>gnl\|CDD\|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>gnl\|CDD\|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk	Back alignment and domain information

>gnl\|CDD\|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase	Back alignment and domain information

>gnl\|CDD\|173657 cd05113, PTKc_Btk_Bmx, Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome	Back alignment and domain information

>gnl\|CDD\|133181 cd05050, PTKc_Musk, Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase	Back alignment and domain information

>gnl\|CDD\|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>gnl\|CDD\|173634 cd05053, PTKc_FGFR, Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors	Back alignment and domain information

>gnl\|CDD\|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>gnl\|CDD\|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>gnl\|CDD\|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros	Back alignment and domain information

>gnl\|CDD\|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>gnl\|CDD\|132971 cd06640, STKc_MST4, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>gnl\|CDD\|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>gnl\|CDD\|173641 cd05072, PTKc_Lyn, Catalytic domain of the Protein Tyrosine Kinase, Lyn	Back alignment and domain information

>gnl\|CDD\|133199 cd05068, PTKc_Frk_like, Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>gnl\|CDD\|173631 cd05045, PTKc_RET, Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein	Back alignment and domain information

>gnl\|CDD\|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>gnl\|CDD\|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>gnl\|CDD\|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1	Back alignment and domain information

>gnl\|CDD\|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>gnl\|CDD\|173639 cd05066, PTKc_EphR_A, Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors	Back alignment and domain information

>gnl\|CDD\|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5	Back alignment and domain information

>gnl\|CDD\|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>gnl\|CDD\|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7	Back alignment and domain information

>gnl\|CDD\|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase	Back alignment and domain information

>gnl\|CDD\|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|173638 cd05065, PTKc_EphR_B, Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors	Back alignment and domain information

>gnl\|CDD\|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor	Back alignment and domain information

>gnl\|CDD\|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase	Back alignment and domain information

>gnl\|CDD\|173640 cd05067, PTKc_Lck_Blk, Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk	Back alignment and domain information

>gnl\|CDD\|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3	Back alignment and domain information

>gnl\|CDD\|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase	Back alignment and domain information

>gnl\|CDD\|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase	Back alignment and domain information

>gnl\|CDD\|133228 cd05097, PTKc_DDR_like, Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>gnl\|CDD\|133216 cd05085, PTKc_Fer, Catalytic domain of the Protein Tyrosine Kinase, Fer	Back alignment and domain information

>gnl\|CDD\|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6	Back alignment and domain information

>gnl\|CDD\|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>gnl\|CDD\|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha	Back alignment and domain information

>gnl\|CDD\|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>gnl\|CDD\|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>gnl\|CDD\|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>gnl\|CDD\|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>gnl\|CDD\|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173651 cd05095, PTKc_DDR2, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2	Back alignment and domain information

>gnl\|CDD\|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>gnl\|CDD\|133194 cd05063, PTKc_EphR_A2, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2	Back alignment and domain information

>gnl\|CDD\|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2	Back alignment and domain information

>gnl\|CDD\|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota	Back alignment and domain information

>gnl\|CDD\|132950 cd06619, PKc_MKK5, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>gnl\|CDD\|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>gnl\|CDD\|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>gnl\|CDD\|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors	Back alignment and domain information

>gnl\|CDD\|173650 cd05094, PTKc_TrkC, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C	Back alignment and domain information

>gnl\|CDD\|165476 PHA03210, PHA03210, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase	Back alignment and domain information

>gnl\|CDD\|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta	Back alignment and domain information

>gnl\|CDD\|133232 cd05101, PTKc_FGFR2, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2	Back alignment and domain information

>gnl\|CDD\|173649 cd05093, PTKc_TrkB, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B	Back alignment and domain information

>gnl\|CDD\|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase	Back alignment and domain information

>gnl\|CDD\|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein	Back alignment and domain information

>gnl\|CDD\|133204 cd05073, PTKc_Hck, Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase	Back alignment and domain information

>gnl\|CDD\|133229 cd05098, PTKc_FGFR1, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1	Back alignment and domain information

>gnl\|CDD\|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin	Back alignment and domain information

>gnl\|CDD\|133201 cd05070, PTKc_Fyn_Yrk, Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk	Back alignment and domain information

>gnl\|CDD\|173652 cd05100, PTKc_FGFR3, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3	Back alignment and domain information

>gnl\|CDD\|173648 cd05092, PTKc_TrkA, Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A	Back alignment and domain information

>gnl\|CDD\|133230 cd05099, PTKc_FGFR4, Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4	Back alignment and domain information

>gnl\|CDD\|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2	Back alignment and domain information

>gnl\|CDD\|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>gnl\|CDD\|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>gnl\|CDD\|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>gnl\|CDD\|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6	Back alignment and domain information

>gnl\|CDD\|133200 cd05069, PTKc_Yes, Catalytic domain of the Protein Tyrosine Kinase, Yes	Back alignment and domain information

>gnl\|CDD\|173707 cd05616, STKc_cPKC_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta	Back alignment and domain information

>gnl\|CDD\|133202 cd05071, PTKc_Src, Catalytic domain of the Protein Tyrosine Kinase, Src	Back alignment and domain information

>gnl\|CDD\|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1	Back alignment and domain information

>gnl\|CDD\|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes	Back alignment and domain information

>gnl\|CDD\|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4	Back alignment and domain information

>gnl\|CDD\|133247 cd05116, PTKc_Syk, Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase	Back alignment and domain information

>gnl\|CDD\|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase	Back alignment and domain information

>gnl\|CDD\|133192 cd05061, PTKc_InsR, Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor	Back alignment and domain information

>gnl\|CDD\|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional	Back alignment and domain information

>gnl\|CDD\|240344 PTZ00283, PTZ00283, serine/threonine protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>gnl\|CDD\|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1	Back alignment and domain information

>gnl\|CDD\|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173632 cd05051, PTKc_DDR, Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors	Back alignment and domain information

>gnl\|CDD\|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>gnl\|CDD\|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases	Back alignment and domain information

>gnl\|CDD\|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>gnl\|CDD\|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C	Back alignment and domain information

>gnl\|CDD\|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>gnl\|CDD\|133195 cd05064, PTKc_EphR_A10, Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10	Back alignment and domain information

>gnl\|CDD\|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1	Back alignment and domain information

>gnl\|CDD\|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta	Back alignment and domain information

>gnl\|CDD\|133193 cd05062, PTKc_IGF-1R, Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor	Back alignment and domain information

>gnl\|CDD\|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>gnl\|CDD\|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|133246 cd05115, PTKc_Zap-70, Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa	Back alignment and domain information

>gnl\|CDD\|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>gnl\|CDD\|133227 cd05096, PTKc_DDR1, Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1	Back alignment and domain information

>gnl\|CDD\|140307 PTZ00284, PTZ00284, protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron	Back alignment and domain information

>gnl\|CDD\|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>gnl\|CDD\|133233 cd05102, PTKc_VEGFR3, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3	Back alignment and domain information

>gnl\|CDD\|173647 cd05091, PTKc_Ror2, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2	Back alignment and domain information

>gnl\|CDD\|173635 cd05054, PTKc_VEGFR, Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors	Back alignment and domain information

>gnl\|CDD\|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2	Back alignment and domain information

>gnl\|CDD\|133234 cd05103, PTKc_VEGFR2, Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2	Back alignment and domain information

>gnl\|CDD\|133168 cd05036, PTKc_ALK_LTK, Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase	Back alignment and domain information

>gnl\|CDD\|133175 cd05043, PTK_Ryk, Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)	Back alignment and domain information

>gnl\|CDD\|133220 cd05089, PTKc_Tie1, Catalytic domain of the Protein Tyrosine Kinase, Tie1	Back alignment and domain information

>gnl\|CDD\|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>gnl\|CDD\|133205 cd05074, PTKc_Tyro3, Catalytic domain of the Protein Tyrosine Kinase, Tyro3	Back alignment and domain information

>gnl\|CDD\|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase	Back alignment and domain information

>gnl\|CDD\|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>gnl\|CDD\|88330 cd05047, PTKc_Tie, Catalytic domain of Tie Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173646 cd05087, PTKc_Aatyk1_Aatyk3, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3	Back alignment and domain information

>gnl\|CDD\|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4	Back alignment and domain information

>gnl\|CDD\|133167 cd05035, PTKc_Axl_like, Catalytic Domain of Axl-like Protein Tyrosine Kinases	Back alignment and domain information

>gnl\|CDD\|173642 cd05075, PTKc_Axl, Catalytic domain of the Protein Tyrosine Kinase, Axl	Back alignment and domain information

>gnl\|CDD\|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional	Back alignment and domain information

>gnl\|CDD\|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha	Back alignment and domain information

>gnl\|CDD\|173667 cd05576, STKc_RPK118_like, Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins	Back alignment and domain information

>gnl\|CDD\|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit	Back alignment and domain information

>gnl\|CDD\|133217 cd05086, PTKc_Aatyk2, Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2	Back alignment and domain information

>gnl\|CDD\|133237 cd05106, PTKc_CSF-1R, Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor	Back alignment and domain information

>gnl\|CDD\|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>gnl\|CDD\|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta	Back alignment and domain information

>gnl\|CDD\|173766 cd08226, PK_STRAD_beta, Pseudokinase domain of STE20-related kinase adapter protein beta	Back alignment and domain information

>gnl\|CDD\|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>gnl\|CDD\|173653 cd05105, PTKc_PDGFR_alpha, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha	Back alignment and domain information

>gnl\|CDD\|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional	Back alignment and domain information

>gnl\|CDD\|133238 cd05107, PTKc_PDGFR_beta, Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta	Back alignment and domain information

>gnl\|CDD\|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor	Back alignment and domain information

>gnl\|CDD\|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha	Back alignment and domain information

>gnl\|CDD\|173655 cd05110, PTKc_HER4, Catalytic domain of the Protein Tyrosine Kinase, HER4	Back alignment and domain information

>gnl\|CDD\|173656 cd05111, PTK_HER3, Pseudokinase domain of the Protein Tyrosine Kinase, HER3	Back alignment and domain information

>gnl\|CDD\|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>gnl\|CDD\|133240 cd05109, PTKc_HER2, Catalytic domain of the Protein Tyrosine Kinase, HER2	Back alignment and domain information

>gnl\|CDD\|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|165291 PHA02988, PHA02988, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>gnl\|CDD\|234331 TIGR03724, arch_bud32, Kae1-associated kinase Bud32	Back alignment and domain information

>gnl\|CDD\|236586 PRK09605, PRK09605, bifunctional UGMP family protein/serine/threonine protein kinase; Validated	Back alignment and domain information

>gnl\|CDD\|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|237847 PRK14879, PRK14879, serine/threonine protein kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|224632 COG1718, RIO1, Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]	Back alignment and domain information

>gnl\|CDD\|214801 smart00750, KIND, kinase non-catalytic C-lobe domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		432
KOG0661		538	consensus MAPK related serine/threonine protein ki	100.0
KOG0658		364	consensus Glycogen synthase kinase-3 [Carbohydrate	100.0
KOG0593		396	consensus Predicted protein kinase KKIAMRE [Genera	100.0
KOG0659		318	consensus Cdk activating kinase (CAK)/RNA polymera	100.0
KOG0660		359	consensus Mitogen-activated protein kinase [Signal	100.0
KOG0600		560	consensus Cdc2-related protein kinase [Cell cycle	100.0
KOG0663		419	consensus Protein kinase PITSLRE and related kinas	100.0
KOG0615		475	consensus Serine/threonine protein kinase Chk2 and	100.0
KOG0594		323	consensus Protein kinase PCTAIRE and related kinas	100.0
KOG0598		357	consensus Ribosomal protein S6 kinase and related	100.0
KOG0575		592	consensus Polo-like serine/threonine protein kinas	100.0
KOG0581		364	consensus Mitogen-activated protein kinase kinase	100.0
KOG0667		586	consensus Dual-specificity tyrosine-phosphorylatio	100.0
KOG0592		604	consensus 3-phosphoinositide-dependent protein kin	100.0
KOG0605		550	consensus NDR and related serine/threonine kinases	100.0
KOG0616		355	consensus cAMP-dependent protein kinase catalytic	100.0
cd07871		288	STKc_PCTAIRE3 Catalytic domain of the Serine/Threo	100.0
KOG0694		694	consensus Serine/threonine protein kinase [Signal	100.0
KOG0595		429	consensus Serine/threonine-protein kinase involved	100.0
KOG0662		292	consensus Cyclin-dependent kinase CDK5 [Intracellu	100.0
cd07869		303	STKc_PFTAIRE1 Catalytic domain of the Serine/Threo	100.0
KOG0666		438	consensus Cyclin C-dependent kinase CDK8 [Transcri	100.0
PTZ00036		440	glycogen synthase kinase; Provisional	100.0
cd07872		309	STKc_PCTAIRE2 Catalytic domain of the Serine/Threo	100.0
KOG0583		370	consensus Serine/threonine protein kinase [Signal	100.0
KOG0033		355	consensus Ca2+/calmodulin-dependent protein kinase	100.0
KOG0597		808	consensus Serine-threonine protein kinase FUSED [G	100.0
KOG0588		786	consensus Serine/threonine protein kinase [Cell cy	100.0
KOG0198		313	consensus MEKK and related serine/threonine protei	100.0
cd07848		287	STKc_CDKL5 Catalytic domain of the Serine/Threonin	100.0
cd07873		301	STKc_PCTAIRE1 Catalytic domain of the Serine/Threo	100.0
cd07862		290	STKc_CDK6 Catalytic domain of the Serine/Threonine	100.0
cd07859		338	STKc_TDY_MAPK_plant Catalytic domain of the Serine	100.0
KOG0578		550	consensus p21-activated serine/threonine protein k	100.0
KOG0591		375	consensus NIMA (never in mitosis)-related G2-speci	100.0
cd05612		291	STKc_PRKX_like Catalytic domain of PRKX-like Prote	100.0
cd07853		372	STKc_NLK Catalytic domain of the Serine/Threonine	100.0
PTZ00263		329	protein kinase A catalytic subunit; Provisional	100.0
cd05571		323	STKc_PKB Catalytic domain of the Protein Serine/Th	100.0
cd07863		288	STKc_CDK4 Catalytic domain of the Serine/Threonine	100.0
cd07876		359	STKc_JNK2 Catalytic domain of the Serine/Threonine	100.0
cd07875		364	STKc_JNK1 Catalytic domain of the Serine/Threonine	100.0
KOG0582		516	consensus Ste20-like serine/threonine protein kina	100.0
PTZ00426		340	cAMP-dependent protein kinase catalytic subunit; P	100.0
KOG0032		382	consensus Ca2+/calmodulin-dependent protein kinase	100.0
cd05628		363	STKc_NDR1 Catalytic domain of the Protein Serine/T	100.0
KOG0669		376	consensus Cyclin T-dependent kinase CDK9 [Cell cyc	100.0
cd05591		321	STKc_nPKC_epsilon Catalytic domain of the Protein	100.0
KOG0610		459	consensus Putative serine/threonine protein kinase	100.0
cd05631		285	STKc_GRK4 Catalytic domain of the Protein Serine/T	100.0
cd05599		364	STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel	100.0
KOG0585		576	consensus Ca2+/calmodulin-dependent protein kinase	100.0
cd07878		343	STKc_p38beta_MAPK11 Catalytic domain of the Serine	100.0
cd05590		320	STKc_nPKC_eta Catalytic domain of the Protein Seri	100.0
cd05629		377	STKc_NDR_like_fungal Catalytic domain of Fungal Nu	100.0
cd05600		333	STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p-	100.0
cd07874		355	STKc_JNK3 Catalytic domain of the Serine/Threonine	100.0
cd05587		324	STKc_cPKC Catalytic domain of the Protein Serine/T	100.0
cd07831		282	STKc_MOK Catalytic domain of the Serine/Threonine	100.0
cd05570		318	STKc_PKC Catalytic domain of the Protein Serine/Th	100.0
cd05626		381	STKc_LATS2 Catalytic domain of the Protein Serine/	100.0
cd05625		382	STKc_LATS1 Catalytic domain of the Protein Serine/	100.0
PHA03212		391	serine/threonine kinase US3; Provisional	100.0
cd05588		329	STKc_aPKC Catalytic domain of the Protein Serine/T	100.0
cd07844		291	STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like	100.0
cd07832		286	STKc_CCRK Catalytic domain of the Serine/Threonine	100.0
cd07845		309	STKc_CDK10 Catalytic domain of the Serine/Threonin	100.0
cd05616		323	STKc_cPKC_beta Catalytic domain of the Protein Ser	100.0
cd05596		370	STKc_ROCK Catalytic domain of the Protein Serine/T	100.0
cd07839		284	STKc_CDK5 Catalytic domain of the Serine/Threonine	100.0
cd07861		285	STKc_CDK1_euk Catalytic domain of the Serine/Threo	100.0
cd05573		350	STKc_ROCK_NDR_like Catalytic domain of ROCK- and N	100.0
cd05618		329	STKc_aPKC_iota Catalytic domain of the Protein Ser	100.0
KOG0599		411	consensus Phosphorylase kinase gamma subunit [Carb	100.0
cd07868		317	STKc_CDK8 Catalytic domain of the Serine/Threonine	100.0
KOG0690		516	consensus Serine/threonine protein kinase [Signal	100.0
cd05598		376	STKc_LATS Catalytic domain of the Protein Serine/T	100.0
cd05593		328	STKc_PKB_gamma Catalytic domain of the Protein Ser	100.0
cd05617		327	STKc_aPKC_zeta Catalytic domain of the Protein Ser	100.0
cd05589		324	STKc_PKN Catalytic domain of the Protein Serine/Th	100.0
cd05592		316	STKc_nPKC_theta_delta Catalytic domain of the Prot	100.0
KOG0580		281	consensus Serine/threonine protein kinase [Cell cy	100.0
cd05585		312	STKc_YPK1_like Catalytic domain of Yeast Protein K	100.0
cd05601		330	STKc_CRIK Catalytic domain of the Protein Serine/T	100.0
cd05621		370	STKc_ROCK2 Catalytic domain of the Protein Serine/	100.0
cd05595		323	STKc_PKB_beta Catalytic domain of the Protein Seri	100.0
PTZ00284		467	protein kinase; Provisional	100.0
cd05627		360	STKc_NDR2 Catalytic domain of the Protein Serine/T	100.0
KOG4717		864	consensus Serine/threonine protein kinase [Signal	100.0
cd06649		331	PKc_MEK2 Catalytic domain of the dual-specificity	100.0
cd05614		332	STKc_MSK2_N N-terminal catalytic domain of the Pro	100.0
cd05619		316	STKc_nPKC_theta Catalytic domain of the Protein Se	100.0
KOG0696		683	consensus Serine/threonine protein kinase [Signal	100.0
KOG0201		467	consensus Serine/threonine protein kinase [Signal	100.0
cd05620		316	STKc_nPKC_delta Catalytic domain of the Protein Se	100.0
PHA03209		357	serine/threonine kinase US3; Provisional	100.0
cd07843		293	STKc_CDC2L1 Catalytic domain of the Serine/Threoni	100.0
cd05594		325	STKc_PKB_alpha Catalytic domain of the Protein Ser	100.0
KOG0611		668	consensus Predicted serine/threonine protein kinas	100.0
cd07870		291	STKc_PFTAIRE2 Catalytic domain of the Serine/Threo	100.0
cd05605		285	STKc_GRK4_like Catalytic domain of G protein-coupl	100.0
cd07847		286	STKc_CDKL1_4 Catalytic domain of the Serine/Threon	100.0
KOG0589		426	consensus Serine/threonine protein kinase [General	100.0
cd05615		323	STKc_cPKC_alpha Catalytic domain of the Protein Se	100.0
cd05597		331	STKc_DMPK_like Catalytic domain of Myotonic Dystro	100.0
cd05584		323	STKc_p70S6K Catalytic domain of the Protein Serine	100.0
cd07836		284	STKc_Pho85 Catalytic domain of the Serine/Threonin	100.0
cd07860		284	STKc_CDK2_3 Catalytic domain of the Serine/Threoni	100.0
KOG0668		338	consensus Casein kinase II, alpha subunit [Signal	100.0
cd07830		283	STKc_MAK_like Catalytic domain of Male germ cell-A	100.0
PLN00009		294	cyclin-dependent kinase A; Provisional	100.0
cd05622		371	STKc_ROCK1 Catalytic domain of the Protein Serine/	100.0
cd05586		330	STKc_Sck1_like Catalytic domain of Suppressor of l	100.0
cd07837		295	STKc_CdkB_plant Catalytic domain of the Serine/Thr	100.0
cd07841		298	STKc_CDK7 Catalytic domain of the Serine/Threonine	100.0
cd07866		311	STKc_BUR1 Catalytic domain of the Serine/Threonine	100.0
cd05623		332	STKc_MRCK_alpha Catalytic domain of the Protein Se	100.0
cd05604		325	STKc_SGK3 Catalytic domain of the Protein Serine/T	100.0
cd05575		323	STKc_SGK Catalytic domain of the Protein Serine/Th	100.0
PLN00034		353	mitogen-activated protein kinase kinase; Provision	100.0
cd07849		336	STKc_ERK1_2_like Catalytic domain of Extracellular	100.0
cd07865		310	STKc_CDK9 Catalytic domain of the Serine/Threonine	100.0
KOG0695		593	consensus Serine/threonine protein kinase [Signal	100.0
cd07846		286	STKc_CDKL2_3 Catalytic domain of the Serine/Threon	100.0
cd07867		317	STKc_CDC2L6 Catalytic domain of Serine/Threonine K	100.0
cd05624		331	STKc_MRCK_beta Catalytic domain of the Protein Ser	100.0
cd05118		283	STKc_CMGC Catalytic domain of CMGC family Serine/T	100.0
cd05603		321	STKc_SGK2 Catalytic domain of the Protein Serine/T	100.0
PHA03207		392	serine/threonine kinase US3; Provisional	100.0
KOG0604		400	consensus MAP kinase-activated protein kinase 2 [S	100.0
cd05602		325	STKc_SGK1 Catalytic domain of the Protein Serine/T	100.0
cd05582		318	STKc_RSK_N N-terminal catalytic domain of the Prot	100.0
cd07850		353	STKc_JNK Catalytic domain of the Serine/Threonine	100.0
cd05608		280	STKc_GRK1 Catalytic domain of the Protein Serine/T	100.0
cd07833		288	STKc_CDKL Catalytic domain of Cyclin-Dependent pro	100.0
cd07858		337	STKc_TEY_MAPK_plant Catalytic domain of the Serine	100.0
PHA03211		461	serine/threonine kinase US3; Provisional	100.0
cd06650		333	PKc_MEK1 Catalytic domain of the dual-specificity	100.0
PF00069		260	Pkinase: Protein kinase domain Protein kinase; unc	100.0
KOG0986		591	consensus G protein-coupled receptor kinase [Signa	100.0
cd07855		334	STKc_ERK5 Catalytic domain of the Serine/Threonine	100.0
cd07864		302	STKc_CDK12 Catalytic domain of the Serine/Threonin	100.0
cd07834		330	STKc_MAPK Catalytic domain of the Serine/Threonine	100.0
cd07835		283	STKc_CDK1_like Catalytic domain of Cyclin-Dependen	100.0
cd07840		287	STKc_CDK9_like Catalytic domain of Cyclin-Dependen	100.0
KOG0664		449	consensus Nemo-like MAPK-related serine/threonine	100.0
cd05607		277	STKc_GRK7 Catalytic domain of the Protein Serine/T	100.0
cd05630		285	STKc_GRK6 Catalytic domain of the Protein Serine/T	100.0
PTZ00024		335	cyclin-dependent protein kinase; Provisional	100.0
KOG0665		369	consensus Jun-N-terminal kinase (JNK) [Signal tran	100.0
KOG0671		415	consensus LAMMER dual specificity kinases [Signal	100.0
cd07829		282	STKc_CDK_like Catalytic domain of Cyclin-Dependent	100.0
KOG0192		362	consensus Tyrosine kinase specific for activated (	100.0
cd07842		316	STKc_CDK8_like Catalytic domain of Cyclin-Dependen	100.0
cd06625		263	STKc_MEKK3_like Catalytic domain of MAP/ERK kinase	100.0
KOG0612		1317	consensus Rho-associated, coiled-coil containing p	100.0
cd05632		285	STKc_GRK5 Catalytic domain of the Protein Serine/T	100.0
KOG4236		888	consensus Serine/threonine protein kinase PKC mu/P	100.0
cd07854		342	STKc_MAPK4_6 Catalytic domain of the Serine/Threon	100.0
cd06617		283	PKc_MKK3_6 Catalytic domain of the dual-specificit	100.0
cd07857		332	STKc_MPK1 Catalytic domain of the Serine/Threonine	100.0
cd06615		308	PKc_MEK Catalytic domain of the dual-specificity P	100.0
KOG0579		1187	consensus Ste20-like serine/threonine protein kina	100.0
KOG0574		502	consensus STE20-like serine/threonine kinase MST [	100.0
cd05580		290	STKc_PKA Catalytic domain of the Protein Serine/Th	100.0
cd08227		327	PK_STRAD_alpha Pseudokinase domain of STE20-relate	100.0
PTZ00267		478	NIMA-related protein kinase; Provisional	100.0
cd07879		342	STKc_p38delta_MAPK13 Catalytic domain of the Serin	100.0
cd05574		316	STKc_phototropin_like Catalytic domain of Phototro	100.0
cd07877		345	STKc_p38alpha_MAPK14 Catalytic domain of the Serin	100.0
cd06622		286	PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS	100.0
cd06619		279	PKc_MKK5 Catalytic domain of the dual-specificity	100.0
KOG0614		732	consensus cGMP-dependent protein kinase [Signal tr	100.0
PTZ00266		1021	NIMA-related protein kinase; Provisional	100.0
cd07851		343	STKc_p38 Catalytic domain of the Serine/Threonine	100.0
cd06610		267	STKc_OSR1_SPAK Catalytic domain of the Protein Ser	100.0
KOG0596		677	consensus Dual specificity; serine/threonine and t	100.0
KOG0983		391	consensus Mitogen-activated protein kinase (MAPK)	100.0
cd06644		292	STKc_STK10_LOK Catalytic domain of the Protein Ser	100.0
cd05102		338	PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi	100.0
PTZ00283		496	serine/threonine protein kinase; Provisional	100.0
KOG0577		948	consensus Serine/threonine protein kinase [Signal	100.0
PHA03210		501	serine/threonine kinase US3; Provisional	100.0
cd07880		343	STKc_p38gamma_MAPK12 Catalytic domain of the Serin	100.0
cd07838		287	STKc_CDK4_6_like Catalytic domain of Cyclin-Depend	100.0
cd06609		274	STKc_MST3_like Catalytic domain of Mammalian Ste20	100.0
cd06646		267	STKc_MAP4K5 Catalytic domain of the Protein Serine	100.0
cd07852		337	STKc_MAPK15 Catalytic domain of the Serine/Threoni	100.0
cd08223		257	STKc_Nek4 Catalytic domain of the Protein Serine/T	100.0
cd06645		267	STKc_MAP4K3 Catalytic domain of the Protein Serine	100.0
KOG4279		1226	consensus Serine/threonine protein kinase [Signal	100.0
cd06643		282	STKc_SLK Catalytic domain of the Protein Serine/Th	100.0
cd05609		305	STKc_MAST Catalytic domain of the Protein Serine/T	100.0
cd06613		262	STKc_MAP4K3_like Catalytic domain of Mitogen-activ	100.0
cd08220		256	STKc_Nek8 Catalytic domain of the Protein Serine/T	100.0
cd06616		288	PKc_MKK4 Catalytic domain of the dual-specificity	100.0
cd05633		279	STKc_GRK3 Catalytic domain of the Protein Serine/T	100.0
cd06628		267	STKc_MAPKKK_Byr2_like Catalytic domain of fungal B	100.0
cd06611		280	STKc_SLK_like Catalytic domain of Ste20-like kinas	100.0
cd07856		328	STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre	100.0
cd06654		296	STKc_PAK1 Catalytic domain of the Protein Serine/T	100.0
cd05572		262	STKc_cGK_PKG Catalytic domain of the Protein Serin	100.0
cd06637		272	STKc_TNIK Catalytic domain of the Protein Serine/T	100.0
cd06630		268	STKc_MEKK1 Catalytic domain of the Protein Serine/	100.0
cd08529		256	STKc_FA2-like Catalytic domain of the Protein Seri	100.0
cd06631		265	STKc_YSK4 Catalytic domain of the Protein Serine/T	100.0
cd06632		258	STKc_MEKK1_plant Catalytic domain of the Protein S	100.0
cd05578		258	STKc_Yank1 Catalytic domain of the Protein Serine/	100.0
KOG0586		596	consensus Serine/threonine protein kinase [General	100.0
KOG0607		463	consensus MAP kinase-interacting kinase and relate	100.0
KOG0197		468	consensus Tyrosine kinases [Signal transduction me	100.0
cd06655		296	STKc_PAK2 Catalytic domain of the Protein Serine/T	100.0
cd05606		278	STKc_beta_ARK Catalytic domain of the Protein Seri	100.0
cd06651		266	STKc_MEKK3 Catalytic domain of the Protein Serine/	100.0
cd08221		256	STKc_Nek9 Catalytic domain of the Protein Serine/T	100.0
cd06612		256	STKc_MST1_2 Catalytic domain of the Protein Serine	100.0
KOG0670		752	consensus U4/U6-associated splicing factor PRP4 [R	100.0
cd06656		297	STKc_PAK3 Catalytic domain of the Protein Serine/T	100.0
cd05064		266	PTKc_EphR_A10 Catalytic domain of the Protein Tyro	100.0
cd06605		265	PKc_MAPKK Catalytic domain of the dual-specificity	100.0
cd06607		307	STKc_TAO Catalytic domain of the Protein Serine/Th	100.0
cd05577		277	STKc_GRK Catalytic domain of the Protein Serine/Th	100.0
cd06629		272	STKc_MAPKKK_Bck1_like Catalytic domain of fungal B	100.0
cd06652		265	STKc_MEKK2 Catalytic domain of the Protein Serine/	100.0
cd06636		282	STKc_MAP4K4_6 Catalytic domain of the Protein Seri	100.0
KOG1290		590	consensus Serine/threonine protein kinase [Signal	100.0
cd06623		264	PKc_MAPKK_plant_like Catalytic domain of Plant dua	100.0
cd06917		277	STKc_NAK1_like Catalytic domain of Fungal Nak1-lik	100.0
cd08218		256	STKc_Nek1 Catalytic domain of the Protein Serine/T	100.0
cd06608		275	STKc_myosinIII_like Catalytic domain of Class III	100.0
cd06620		284	PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr	100.0
cd06640		277	STKc_MST4 Catalytic domain of the Protein Serine/T	100.0
cd06658		292	STKc_PAK5 Catalytic domain of the Protein Serine/T	100.0
cd06638		286	STKc_myosinIIIA Catalytic domain of the Protein Se	100.0
cd06639		291	STKc_myosinIIIB Catalytic domain of the Protein Se	100.0
cd05611		260	STKc_Rim15_like Catalytic domain of fungal Rim15-l	100.0
cd08219		255	STKc_Nek3 Catalytic domain of the Protein Serine/T	100.0
cd08217		265	STKc_Nek2 Catalytic domain of the Protein Serine/T	100.0
cd06626		264	STKc_MEKK4 Catalytic domain of the Protein Serine/	100.0
cd06618		296	PKc_MKK7 Catalytic domain of the dual-specificity	100.0
cd05061		288	PTKc_InsR Catalytic domain of the Protein Tyrosine	100.0
cd05096		304	PTKc_DDR1 Catalytic domain of the Protein Tyrosine	100.0
cd05048		283	PTKc_Ror Catalytic Domain of the Protein Tyrosine	100.0
cd05104		375	PTKc_Kit Catalytic domain of the Protein Tyrosine	100.0
cd05106		374	PTKc_CSF-1R Catalytic domain of the Protein Tyrosi	100.0
cd05579		265	STKc_MAST_like Catalytic domain of Microtubule-ass	100.0
cd06633		313	STKc_TAO3 Catalytic domain of the Protein Serine/T	100.0
KOG0584		632	consensus Serine/threonine protein kinase [General	100.0
KOG0608		1034	consensus Warts/lats-like serine threonine kinases	100.0
PHA02988		283	hypothetical protein; Provisional	100.0
cd06642		277	STKc_STK25-YSK1 Catalytic domain of the Protein Se	100.0
cd06621		287	PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek	100.0
cd05088		303	PTKc_Tie2 Catalytic domain of the Protein Tyrosine	100.0
cd06659		297	STKc_PAK6 Catalytic domain of the Protein Serine/T	100.0
cd08225		257	STKc_Nek5 Catalytic domain of the Protein Serine/T	100.0
cd06641		277	STKc_MST3 Catalytic domain of the Protein Serine/T	100.0
cd06635		317	STKc_TAO1 Catalytic domain of the Protein Serine/T	100.0
cd06634		308	STKc_TAO2 Catalytic domain of the Protein Serine/T	100.0
cd06624		268	STKc_ASK Catalytic domain of the Protein Serine/Th	100.0
KOG1989		738	consensus ARK protein kinase family [Signal transd	100.0
PHA03390		267	pk1 serine/threonine-protein kinase 1; Provisional	100.0
KOG2345		302	consensus Serine/threonine protein kinase/TGF-beta	100.0
cd05122		253	PKc_STE Catalytic domain of STE family Protein Kin	100.0
cd08215		258	STKc_Nek Catalytic domain of the Protein Serine/Th	100.0
cd05610		669	STKc_MASTL Catalytic domain of the Protein Serine/	100.0
cd05613		290	STKc_MSK1_N N-terminal catalytic domain of the Pro	100.0
cd06648		285	STKc_PAK_II Catalytic domain of the Protein Serine	100.0
cd05089		297	PTKc_Tie1 Catalytic domain of the Protein Tyrosine	100.0
cd06647		293	STKc_PAK_I Catalytic domain of the Protein Serine/	100.0
cd08216		314	PK_STRAD Pseudokinase domain of STE20-related kina	100.0
cd05108		316	PTKc_EGFR Catalytic domain of the Protein Tyrosine	100.0
cd05049		280	PTKc_Trk Catalytic domain of the Protein Tyrosine	100.0
cd05054		337	PTKc_VEGFR Catalytic domain of the Protein Tyrosin	100.0
cd05090		283	PTKc_Ror1 Catalytic domain of the Protein Tyrosine	100.0
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	100.0
cd06653		264	STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina	100.0
cd08226		328	PK_STRAD_beta Pseudokinase domain of STE20-related	100.0
cd08222		260	STKc_Nek11 Catalytic domain of the Protein Serine/	100.0
cd05084		252	PTKc_Fes Catalytic domain of the Protein Tyrosine	100.0
cd05062		277	PTKc_IGF-1R Catalytic domain of the Protein Tyrosi	100.0
cd05036		277	PTKc_ALK_LTK Catalytic domain of the Protein Tyros	100.0
cd06627		254	STKc_Cdc7_like Catalytic domain of Cell division c	100.0
cd08228		267	STKc_Nek6 Catalytic domain of the Protein Serine/T	100.0
cd06606		260	STKc_MAPKKK Catalytic domain of the Protein Serine	100.0
cd05581		280	STKc_PDK1 Catalytic domain of the Protein Serine/T	100.0
cd05053		293	PTKc_FGFR Catalytic domain of the Protein Tyrosine	100.0
cd08530		256	STKc_CNK2-like Catalytic domain of the Protein Ser	100.0
cd05033		266	PTKc_EphR Catalytic domain of Ephrin Receptor Prot	100.0
cd05052		263	PTKc_Abl Catalytic domain of the Protein Tyrosine	100.0
cd05051		296	PTKc_DDR Catalytic domain of the Protein Tyrosine	100.0
cd05091		283	PTKc_Ror2 Catalytic domain of the Protein Tyrosine	100.0
cd05114		256	PTKc_Tec_Rlk Catalytic domain of the Protein Tyros	100.0
cd05109		279	PTKc_HER2 Catalytic domain of the Protein Tyrosine	100.0
cd06657		292	STKc_PAK4 Catalytic domain of the Protein Serine/T	100.0
PRK13184		932	pknD serine/threonine-protein kinase; Reviewed	100.0
cd05072		261	PTKc_Lyn Catalytic domain of the Protein Tyrosine	100.0
KOG4645		1509	consensus MAPKKK (MAP kinase kinase kinase) SSK2 a	100.0
cd05032		277	PTKc_InsR_like Catalytic domain of Insulin Recepto	100.0
cd05113		256	PTKc_Btk_Bmx Catalytic domain of the Protein Tyros	100.0
cd05105		400	PTKc_PDGFR_alpha Catalytic domain of the Protein T	100.0
cd06614		286	STKc_PAK Catalytic domain of the Protein Serine/Th	100.0
cd05065		269	PTKc_EphR_B Catalytic domain of the Protein Tyrosi	100.0
cd05093		288	PTKc_TrkB Catalytic domain of the Protein Tyrosine	100.0
cd00192		262	PTKc Catalytic domain of Protein Tyrosine Kinases.	100.0
cd05055		302	PTKc_PDGFR Catalytic domain of the Protein Tyrosin	100.0
cd05066		267	PTKc_EphR_A Catalytic domain of the Protein Tyrosi	100.0
cd05035		273	PTKc_Axl_like Catalytic Domain of Axl-like Protein	100.0
cd05583		288	STKc_MSK_N N-terminal catalytic domain of the Prot	100.0
cd08229		267	STKc_Nek7 Catalytic domain of the Protein Serine/T	100.0
cd05063		268	PTKc_EphR_A2 Catalytic domain of the Protein Tyros	100.0
cd05059		256	PTKc_Tec_like Catalytic domain of Tec-like Protein	100.0
cd05111		279	PTK_HER3 Pseudokinase domain of the Protein Tyrosi	100.0
cd05068		261	PTKc_Frk_like Catalytic domain of Fyn-related kina	100.0
cd05097		295	PTKc_DDR_like Catalytic domain of Discoidin Domain	100.0
cd05071		262	PTKc_Src Catalytic domain of the Protein Tyrosine	100.0
cd05116		257	PTKc_Syk Catalytic domain of the Protein Tyrosine	100.0
cd05070		260	PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros	100.0
cd05101		304	PTKc_FGFR2 Catalytic domain of the Protein Tyrosin	100.0
cd05099		314	PTKc_FGFR4 Catalytic domain of the Protein Tyrosin	100.0
cd05080		283	PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the	100.0
cd05148		261	PTKc_Srm_Brk Catalytic domain of the Protein Tyros	100.0
cd05098		307	PTKc_FGFR1 Catalytic domain of the Protein Tyrosin	100.0
cd05123		250	STKc_AGC Catalytic domain of AGC family Protein Se	100.0
cd08224		267	STKc_Nek6_Nek7 Catalytic domain of the Protein Ser	100.0
cd05045		290	PTKc_RET Catalytic domain of the Protein Tyrosine	100.0
cd05075		272	PTKc_Axl Catalytic domain of the Protein Tyrosine	100.0
KOG4721		904	consensus Serine/threonine protein kinase, contain	100.0
cd05082		256	PTKc_Csk Catalytic domain of the Protein Tyrosine	100.0
cd05092		280	PTKc_TrkA Catalytic domain of the Protein Tyrosine	100.0
PF07714		259	Pkinase_Tyr: Protein tyrosine kinase Protein kinas	100.0
cd05047		270	PTKc_Tie Catalytic domain of Tie Protein Tyrosine	100.0
cd05039		256	PTKc_Csk_like Catalytic domain of C-terminal Src k	100.0
cd05060		257	PTKc_Syk_like Catalytic domain of Spleen Tyrosine	100.0
cd05094		291	PTKc_TrkC Catalytic domain of the Protein Tyrosine	100.0
cd05050		288	PTKc_Musk Catalytic domain of the Protein Tyrosine	100.0
smart00219		258	TyrKc Tyrosine kinase, catalytic domain. Phosphotr	100.0
cd05100		334	PTKc_FGFR3 Catalytic domain of the Protein Tyrosin	100.0
cd05103		343	PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi	100.0
cd05057		279	PTKc_EGFR_like Catalytic domain of Epidermal Growt	100.0
cd05067		260	PTKc_Lck_Blk Catalytic domain of the Protein Tyros	100.0
cd05115		257	PTKc_Zap-70 Catalytic domain of the Protein Tyrosi	100.0
cd05056		270	PTKc_FAK Catalytic domain of the Protein Tyrosine	100.0
cd05034		261	PTKc_Src_like Catalytic domain of Src kinase-like	100.0
cd05095		296	PTKc_DDR2 Catalytic domain of the Protein Tyrosine	100.0
cd05041		251	PTKc_Fes_like Catalytic domain of Fes-like Protein	100.0
cd05079		284	PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the	100.0
cd05043		280	PTK_Ryk Pseudokinase domain of Ryk (Receptor relat	100.0
PLN03225		566	Serine/threonine-protein kinase SNT7; Provisional	100.0
cd05085		250	PTKc_Fer Catalytic domain of the Protein Tyrosine	100.0
KOG4250		732	consensus TANK binding protein kinase TBK1 [Signal	100.0
KOG1151		775	consensus Tousled-like protein kinase [Signal tran	100.0
cd05107		401	PTKc_PDGFR_beta Catalytic domain of the Protein Ty	100.0
KOG1035		1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	100.0
cd05077		262	PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th	100.0
cd05042		269	PTKc_Aatyk Catalytic domain of the Protein Tyrosin	100.0
cd05078		258	PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain	100.0
cd05073		260	PTKc_Hck Catalytic domain of the Protein Tyrosine	100.0
cd05069		260	PTKc_Yes Catalytic domain of the Protein Tyrosine	100.0
cd05576		237	STKc_RPK118_like Catalytic domain of the Protein S	100.0
KOG1006		361	consensus Mitogen-activated protein kinase (MAPK)	100.0
cd05112		256	PTKc_Itk Catalytic domain of the Protein Tyrosine	100.0
cd05046		275	PTK_CCK4 Pseudokinase domain of the Protein Tyrosi	100.0
cd05040		257	PTKc_Ack_like Catalytic domain of the Protein Tyro	100.0
cd05076		274	PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th	100.0
cd05110		303	PTKc_HER4 Catalytic domain of the Protein Tyrosine	100.0
cd05087		269	PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein	100.0
cd05058		262	PTKc_Met_Ron Catalytic domain of the Protein Tyros	100.0
cd05081		284	PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of	100.0
cd05083		254	PTKc_Chk Catalytic domain of the Protein Tyrosine	100.0
cd05037		259	PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the	100.0
cd05044		269	PTKc_c-ros Catalytic domain of the Protein Tyrosin	100.0
cd08528		269	STKc_Nek10 Catalytic domain of the Protein Serine/	100.0
PHA02882		294	putative serine/threonine kinase; Provisional	100.0
KOG1187		361	consensus Serine/threonine protein kinase [Signal	100.0
KOG0193		678	consensus Serine/threonine protein kinase RAF [Sig	100.0
KOG0194		474	consensus Protein tyrosine kinase [Signal transduc	100.0
cd05086		268	PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi	100.0
KOG1026		774	consensus Nerve growth factor receptor TRKA and re	100.0
cd05038		284	PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P	100.0
cd05074		273	PTKc_Tyro3 Catalytic domain of the Protein Tyrosin	100.0
KOG0587		953	consensus Traf2- and Nck-interacting kinase and re	100.0
KOG1167		418	consensus Serine/threonine protein kinase of the C	100.0
KOG1095		1025	consensus Protein tyrosine kinase [Signal transduc	100.0
smart00220		244	S_TKc Serine/Threonine protein kinases, catalytic	100.0
PLN03224		507	probable serine/threonine protein kinase; Provisio	100.0
KOG4257		974	consensus Focal adhesion tyrosine kinase FAK, cont	100.0
KOG0196		996	consensus Tyrosine kinase, EPH (ephrin) receptor f	100.0
KOG1027		903	consensus Serine/threonine protein kinase and endo	100.0
KOG0199		1039	consensus ACK and related non-receptor tyrosine ki	100.0
KOG0984		282	consensus Mitogen-activated protein kinase (MAPK)	100.0
KOG4278		1157	consensus Protein tyrosine kinase [Signal transduc	100.0
KOG1094		807	consensus Discoidin domain receptor DDR1 [Signal t	100.0
PLN00113		968	leucine-rich repeat receptor-like protein kinase;	100.0
KOG0576		829	consensus Mitogen-activated protein kinase kinase	100.0
KOG0200		609	consensus Fibroblast/platelet-derived growth facto	100.0
KOG1152		772	consensus Signal transduction serine/threonine kin	99.98
KOG1025		1177	consensus Epidermal growth factor receptor EGFR an	99.98
cd00180		215	PKc Catalytic domain of Protein Kinases. Protein K	99.98
KOG3653		534	consensus Transforming growth factor beta/activin	99.97
smart00221		225	STYKc Protein kinase; unclassified specificity. Ph	99.97
PLN00181		793	protein SPA1-RELATED; Provisional	99.97
KOG1345		378	consensus Serine/threonine kinase [Signal transduc	99.97
KOG2052		513	consensus Activin A type IB receptor, serine/threo	99.96
smart00750		176	KIND kinase non-catalytic C-lobe domain. It is an	99.95
COG0515		384	SPS1 Serine/threonine protein kinase [General func	99.95
KOG0590		601	consensus Checkpoint kinase and related serine/thr	99.95
PRK09188		365	serine/threonine protein kinase; Provisional	99.94
KOG1024		563	consensus Receptor-like protein tyrosine kinase RY	99.94
KOG1164		322	consensus Casein kinase (serine/threonine/tyrosine	99.93
KOG0603		612	consensus Ribosomal protein S6 kinase [Signal tran	99.93
KOG1163		341	consensus Casein kinase (serine/threonine/tyrosine	99.93
KOG1165		449	consensus Casein kinase (serine/threonine/tyrosine	99.92
KOG0606		1205	consensus Microtubule-associated serine/threonine	99.92
cd05147		190	RIO1_euk RIO kinase family; eukaryotic RIO1, catal	99.91
PRK10359		232	lipopolysaccharide core biosynthesis protein; Prov	99.9
KOG4158		598	consensus BRPK/PTEN-induced protein kinase [Signal	99.9
KOG1240		1431	consensus Protein kinase containing WD40 repeats [	99.89
cd05145		190	RIO1_like RIO kinase family; RIO1, RIO3 and simila	99.89
PF14531		288	Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_	99.88
PRK12274		218	serine/threonine protein kinase; Provisional	99.86
smart00090		237	RIO RIO-like kinase.	99.84
PRK10345		210	hypothetical protein; Provisional	99.83
KOG1166		974	consensus Mitotic checkpoint serine/threonine prot	99.82
PRK14879		211	serine/threonine protein kinase; Provisional	99.79
KOG0590		601	consensus Checkpoint kinase and related serine/thr	99.77
KOG1033		516	consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati	99.77
TIGR03724		199	arch_bud32 Kae1-associated kinase Bud32. Members o	99.76
cd05144		198	RIO2_C RIO kinase family; RIO2, C-terminal catalyt	99.75
PRK09605		535	bifunctional UGMP family protein/serine/threonine	99.75
KOG0195		448	consensus Integrin-linked kinase [Signal transduct	99.73
cd05119		187	RIO RIO kinase family, catalytic domain. The RIO k	99.73
KOG1023		484	consensus Natriuretic peptide receptor, guanylate	99.72
KOG0601		524	consensus Cyclin-dependent kinase WEE1 [Cell cycle	99.67
PRK01723		239	3-deoxy-D-manno-octulosonic-acid kinase; Reviewed	99.65
cd05120		155	APH_ChoK_like Aminoglycoside 3'-phosphotransferase	99.64
KOG0606		1205	consensus Microtubule-associated serine/threonine	99.58
cd05146		197	RIO3_euk RIO kinase family; eukaryotic RIO3, catal	99.51
KOG1243		690	consensus Protein kinase [General function predict	99.5
KOG0601		524	consensus Cyclin-dependent kinase WEE1 [Cell cycle	99.46
cd05151		170	ChoK Choline Kinase (ChoK). The ChoK subfamily is	99.45
PRK04750		537	ubiB putative ubiquinone biosynthesis protein UbiB	99.44
TIGR01982		437	UbiB 2-polyprenylphenol 6-hydroxylase. This model	99.41
KOG1266		458	consensus Protein kinase [Signal transduction mech	99.36
COG3642		204	Mn2+-dependent serine/threonine protein kinase [Si	99.27
KOG3087		229	consensus Serine/threonine protein kinase [General	99.25
KOG3741		655	consensus Poly(A) ribonuclease subunit [RNA proces	99.22
cd05154		223	ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an	99.16
PF01163		188	RIO1: RIO1 family; InterPro: IPR018934 Protein pho	99.07
KOG2137		700	consensus Protein kinase [Signal transduction mech	99.02
PRK15123		268	lipopolysaccharide core heptose(I) kinase RfaP; Pr	98.99
COG0478		304	RIO-like serine/threonine protein kinase fused to	98.91
PF06293		206	Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family;	98.83
COG4248		637	Uncharacterized protein with protein kinase and he	98.83
COG1718		268	RIO1 Serine/threonine protein kinase involved in c	98.76
KOG0576		829	consensus Mitogen-activated protein kinase kinase	98.73
PF06176		229	WaaY: Lipopolysaccharide core biosynthesis protein	98.63
PRK09902		216	hypothetical protein; Provisional	98.54
PF01636		239	APH: Phosphotransferase enzyme family This family	98.48
TIGR02172		226	Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou	98.45
COG0661		517	AarF Predicted unusual protein kinase [General fun	98.39
KOG1035		1351	consensus eIF-2alpha kinase GCN2 [Translation, rib	98.3
PLN02876		822	acyl-CoA dehydrogenase	98.28
cd05150		244	APH Aminoglycoside 3'-phosphotransferase (APH). Th	98.28
KOG1235		538	consensus Predicted unusual protein kinase [Genera	98.22
PF13095		207	FTA2: Kinetochore Sim4 complex subunit FTA2	98.06
COG2112		201	Predicted Ser/Thr protein kinase [Signal transduct	97.99
PF10707		199	YrbL-PhoP_reg: PhoP regulatory network protein Yrb	97.96
PRK09550		401	mtnK methylthioribose kinase; Reviewed	97.87
cd05155		235	APH_ChoK_like_1 Uncharacterized bacterial proteins	97.81
KOG2270		520	consensus Serine/threonine protein kinase involved	97.8
cd05157		235	ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes.	97.8
TIGR02721		256	ycfN_thiK thiamine kinase. Members of this family	97.68
cd05153		296	HomoserineK_II Homoserine Kinase, type II. Homoser	97.58
TIGR00938		307	thrB_alt homoserine kinase, Neisseria type. Homose	97.49
PRK05231		319	homoserine kinase; Provisional	97.48
KOG1826		2724	consensus Ras GTPase activating protein RasGAP/neu	97.47
KOG1093		725	consensus Predicted protein kinase (contains TBC a	97.36
PF12260		188	PIP49_C: Protein-kinase domain of FAM69; InterPro:	97.28
cd05156		302	ChoK_euk Choline Kinase (ChoK) in eukaryotes. The	97.27
TIGR01767		370	MTRK 5-methylthioribose kinase. This enzyme is inv	97.27
COG3173		321	Predicted aminoglycoside phosphotransferase [Gener	97.08
PRK12396		409	5-methylribose kinase; Reviewed	96.92
TIGR02906		313	spore_CotS spore coat protein, CotS family. Member	96.9
PLN02236		344	choline kinase	96.86
KOG2268		465	consensus Serine/threonine protein kinase [Signal	96.74
cd05152		276	MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH	96.7
PLN02421		330	phosphotransferase, alcohol group as acceptor/kina	96.63
PLN02756		418	S-methyl-5-thioribose kinase	96.63
PTZ00384		383	choline kinase; Provisional	96.44
TIGR02904		309	spore_ysxE spore coat protein YsxE. Members of thi	96.22
PRK10593		297	hypothetical protein; Provisional	95.84
PF01633		211	Choline_kinase: Choline/ethanolamine kinase; Inter	95.81
COG5072		488	ALK1 Serine/threonine kinase of the haspin family	95.48
KOG1033		516	consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati	95.23
PRK06148		1013	hypothetical protein; Provisional	95.04
PF03881		288	Fructosamin_kin: Fructosamine kinase; InterPro: IP	94.89
PTZ00296		442	choline kinase; Provisional	94.76
KOG1236		565	consensus Predicted unusual protein kinase [Genera	93.69
PF07387		308	Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099	93.65
PF02958		294	EcKinase: Ecdysteroid kinase; InterPro: IPR004119	93.28

>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

Probab=100.00  E-value=1.1e-81  Score=607.50  Aligned_cols=431  Identities=49%  Similarity=0.826  Sum_probs=369.7

Q ss_pred             CCCeeEeeeEeecCceEEEEEEEcCCCeEEEEEEecccccchHHHHHHHHHHHHHhcC-CCcccccceEEEeCC-EEEEE
Q 014039            1 MERYKILEELGDGTCGCVYKAFNVETYEIVAVKKMKRKFYFWEECMNLREVKALRKLN-HPNIIKLKEVVRENN-ELFFI   78 (432)
Q Consensus         1 ~~~Y~~~~~IG~G~fg~V~~a~~~~~~~~vAiK~i~~~~~~~~~~~~~~Ei~~l~~l~-hpnIv~l~~~~~~~~-~~~lV   78 (432)
                      |+||.++++||.|+||.||+|+.+.+|+.||||++++++..++++..+||++.|++|+ ||||++|++++.++. .+|+|
T Consensus         9 m~RY~~i~klGDGTfGsV~la~~~~~~~~VAIK~MK~Kf~s~ee~~nLREvksL~kln~hpniikL~Evi~d~~~~L~fV   88 (538)
T KOG0661|consen    9 MDRYTVIRKLGDGTFGSVYLAKSKETGELVAIKKMKKKFYSWEECMNLREVKSLRKLNPHPNIIKLKEVIRDNDRILYFV   88 (538)
T ss_pred             HHHHHHHHHhcCCcceeEEEeeecCCCceeeHHHHHhhhccHHHHHHHHHHHHHHhcCCCCcchhhHHHhhccCceEeee
Confidence            6899999999999999999999999999999999999999999999999999999998 999999999998877 99999


Q ss_pred             EecCCCcHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHHHCCCeeccCCCCceeEe-CCeEEEeeeccceecCCCCCCcc
Q 014039           79 FEYMEHNLYHIMRERQIPFSEGEIRSFMSQMLQGLAHMHRNGYFHRDLKPENLLVT-NDVLKIADFGLARELSSMPPYTE  157 (432)
Q Consensus        79 ~E~~~~~ll~~~~~~~~~l~~~~~~~i~~qIl~aL~~LH~~givHrDlkP~NILl~-~~~lkL~DFG~a~~~~~~~~~~~  157 (432)
                      ||||+++|++.++.+++.|++..++.|++||++||+|+|++|+.|||+||+|||+. ++.+||+|||+|+.+...+++++
T Consensus        89 fE~Md~NLYqLmK~R~r~fse~~irnim~QilqGL~hiHk~GfFHRDlKPENiLi~~~~~iKiaDFGLARev~SkpPYTe  168 (538)
T KOG0661|consen   89 FEFMDCNLYQLMKDRNRLFSESDIRNIMYQILQGLAHIHKHGFFHRDLKPENILISGNDVIKIADFGLAREVRSKPPYTE  168 (538)
T ss_pred             HHhhhhhHHHHHhhcCCcCCHHHHHHHHHHHHHHHHHHHhcCcccccCChhheEecccceeEecccccccccccCCCcch
Confidence            99999999999999999999999999999999999999999999999999999999 67999999999999999999999


Q ss_pred             ccCCccccchhhhcCCCCCCcccceechHHHHHHHHhCCCCCCCCChHHHHHHHHHHhCCCCCCCchhhhhhhhhhhccc
Q 014039          158 YVSTRWYRAPEVLLQSSSYSPAIDMWAVGAILAELFTLSPIFPGDSEIDQLYKVCCILGAPDWTAFPEATNISRLISISY  237 (432)
Q Consensus       158 ~~~t~~y~aPE~l~~~~~~~~~~DiWSlG~il~ell~g~~pF~~~~~~d~~~~i~~~~g~p~~~~~~~~~~~~~~~~~~~  237 (432)
                      |+.|+||+|||++++...|+.++|||++|||++|+.+-+|+|+|.++.||+.+|++++|+|.++.|++.....+.+++.+
T Consensus       169 YVSTRWYRAPEvLLrs~~Ys~pvD~wA~GcI~aEl~sLrPLFPG~sE~Dqi~KIc~VLGtP~~~~~~eg~~La~~mnf~~  248 (538)
T KOG0661|consen  169 YVSTRWYRAPEVLLRSGYYSSPVDMWAVGCIMAELYSLRPLFPGASEIDQIYKICEVLGTPDKDSWPEGYNLASAMNFRF  248 (538)
T ss_pred             hhhcccccchHHhhhccccCCchHHHHHHHHHHHHHHhcccCCCCcHHHHHHHHHHHhCCCccccchhHHHHHHHhccCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCCCCccccCCCCCHHHHHHHHHhcccCCCCCCCHHHHhcCCCCCCCCCCCCCCCC----------hhhhhccCCCCC
Q 014039          238 SEILPINLSDIIPNASMEAIDLIWQLCSWDPLRRPTADQALQHPFFNVETWVPYPLHD----------PLELRLNNMGSK  307 (432)
Q Consensus       238 ~~~~~~~~~~~~~~~s~~~~dli~~~L~~dP~~Rpta~elL~Hp~f~~~~~~~~~~~~----------~~~~~~~~~~~~  307 (432)
                      ++..+.++..+.++++.++.++|.+||.+||++||||.|+|+||||+.........+.          |...........
T Consensus       249 P~~~~~~l~~L~p~~s~~~~~li~~ll~WDP~kRpTA~~al~~pffq~~~~~~~~a~~~~~~~~~~~~p~~~~~~~~t~~  328 (538)
T KOG0661|consen  249 PQVKPSPLKDLLPNASSEAASLIERLLAWDPDKRPTASQALQHPFFQVGRASGSSARGSPKKALELAFPVASEPPVPTKE  328 (538)
T ss_pred             CcCCCCChHHhCcccCHHHHHHHHHHhcCCCccCccHHHHhcCccccccccccccccCCccccccccCCCCCCCCCCccc
Confidence            9999999999999999999999999999999999999999999999976543332221          000000001112


Q ss_pred             CCCccCCCCCCCCCCccccCccccccC-ChhhhhccCC--ccccccccccCCCCCCCc-----ceeeeeccC-CCCCCCC
Q 014039          308 PNLELNLWDFGTEPDDCFLGLTLAVKP-SNLEMVHNVP--QGMQEDILFCSDLKDHSE-----QTVFWSLLS-PDQNRMR  378 (432)
Q Consensus       308 ~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~--~~~~~~~~~~~~~~~~~~-----~~~~~~~~~-~~~~~~~  378 (432)
                      .+...+.+.|..++..++.+......| +.......+.  +...++..++|+.++.-.     .+++|.+.+ .+.+...
T Consensus       329 ~~~~~n~~~~~~~~~~~~~~~~~~~~~ks~~~~~~~~n~~~~~~~~~~l~~~v~~~~~~~~l~P~~~~~l~~~~~~s~~~  408 (538)
T KOG0661|consen  329 GPIKKNTSKFLKQPKKSFPPLTSAQPPKSHASGEDRLNSESSTKLSELLNPGVNNDVPAISLRPSVRWPLTSSIKESDDS  408 (538)
T ss_pred             cCcCcchhccccccccccCCcccccCccccccccCCccccccccccccccccccccCccccCCCCcCccccccccccccc
Confidence            345566788888888888888887775 3332233333  334457788898887555     556666433 5566665


Q ss_pred             CCcccc--ccccccccCCC--CCCCCCCCCcccc-ccCCCCcCCccccccCCccc--cCCC
Q 014039          379 APVESS--LSLSFSSIQHP--STGVPQSAGYAIT-SLQPNLLDCPFLAVSSPLQQ--SHCL  432 (432)
Q Consensus       379 ~~~~~~--~~~~~~~~~~~--~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~--~~~~  432 (432)
                      +..+..  +..|.+...+.  +.+.+|+++++.. |.||++.+. |++.++|++|  +|||
T Consensus       409 ~~~~~~~~~lps~~~l~~~~~~~g~~~~~~~~~~~p~~~s~~~~-~~~~~~~~~~~~s~~l  468 (538)
T KOG0661|consen  409 KELKNADQLLPSISRLDSYKPTSGSNQLSGATNSSPRQPSLKDR-EITEKSPFKQKHSHYL  468 (538)
T ss_pred             cccccccccCCccccccccCCCCCCceecCccccCCcchhhhhc-cccccccccccccccC
Confidence            655544  34555555555  7788898888877 599999988 9999999999  9986

>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]	Back alignment and domain information

>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]	Back alignment and domain information

>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]	Back alignment and domain information

>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]	Back alignment and domain information

>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]	Back alignment and domain information

>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]	Back alignment and domain information

>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]	Back alignment and domain information

>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]	Back alignment and domain information

>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]	Back alignment and domain information

>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase	Back alignment and domain information

>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]	Back alignment and domain information

>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase	Back alignment and domain information

>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]	Back alignment and domain information

>PTZ00036 glycogen synthase kinase; Provisional	Back alignment and domain information

>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase	Back alignment and domain information

>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only]	Back alignment and domain information

>KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5	Back alignment and domain information

>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase	Back alignment and domain information

>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6	Back alignment and domain information

>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase	Back alignment and domain information

>PTZ00263 protein kinase A catalytic subunit; Provisional	Back alignment and domain information

>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B	Back alignment and domain information

>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4	Back alignment and domain information

>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2	Back alignment and domain information

>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1	Back alignment and domain information

>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional	Back alignment and domain information

>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]	Back alignment and domain information

>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1	Back alignment and domain information

>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon	Back alignment and domain information

>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4	Back alignment and domain information

>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta	Back alignment and domain information

>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3	Back alignment and domain information

>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C	Back alignment and domain information

>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase	Back alignment and domain information

>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C	Back alignment and domain information

>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2	Back alignment and domain information

>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1	Back alignment and domain information

>PHA03212 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C	Back alignment and domain information

>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases	Back alignment and domain information

>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase	Back alignment and domain information

>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10	Back alignment and domain information

>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta	Back alignment and domain information

>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase	Back alignment and domain information

>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5	Back alignment and domain information

>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like	Back alignment and domain information

>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota	Back alignment and domain information

>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism]	Back alignment and domain information

>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8	Back alignment and domain information

>KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor	Back alignment and domain information

>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma	Back alignment and domain information

>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta	Back alignment and domain information

>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N	Back alignment and domain information

>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta	Back alignment and domain information

>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase	Back alignment and domain information

>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2	Back alignment and domain information

>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta	Back alignment and domain information

>PTZ00284 protein kinase; Provisional	Back alignment and domain information

>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2	Back alignment and domain information

>KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2	Back alignment and domain information

>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2	Back alignment and domain information

>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta	Back alignment and domain information

>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta	Back alignment and domain information

>PHA03209 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1	Back alignment and domain information

>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha	Back alignment and domain information

>KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase	Back alignment and domain information

>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4	Back alignment and domain information

>KOG0589 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha	Back alignment and domain information

>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase	Back alignment and domain information

>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85	Back alignment and domain information

>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3	Back alignment and domain information

>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]	Back alignment and domain information

>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>PLN00009 cyclin-dependent kinase A; Provisional	Back alignment and domain information

>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1	Back alignment and domain information

>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase	Back alignment and domain information

>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7	Back alignment and domain information

>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins	Back alignment and domain information

>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha	Back alignment and domain information

>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3	Back alignment and domain information

>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase	Back alignment and domain information

>PLN00034 mitogen-activated protein kinase kinase; Provisional	Back alignment and domain information

>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases	Back alignment and domain information

>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9	Back alignment and domain information

>KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3	Back alignment and domain information

>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6	Back alignment and domain information

>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta	Back alignment and domain information

>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases	Back alignment and domain information

>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2	Back alignment and domain information

>PHA03207 serine/threonine kinase US3; Provisional	Back alignment and domain information

>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms]	Back alignment and domain information

>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1	Back alignment and domain information

>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase	Back alignment and domain information

>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase	Back alignment and domain information

>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1	Back alignment and domain information

>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases	Back alignment and domain information

>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants	Back alignment and domain information

>PHA03211 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1	Back alignment and domain information

>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity	Back alignment and domain information

>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5	Back alignment and domain information

>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12	Back alignment and domain information

>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases	Back alignment and domain information

>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases	Back alignment and domain information

>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7	Back alignment and domain information

>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6	Back alignment and domain information

>PTZ00024 cyclin-dependent protein kinase; Provisional	Back alignment and domain information

>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases	Back alignment and domain information

>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]	Back alignment and domain information

>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases	Back alignment and domain information

>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5	Back alignment and domain information

>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]	Back alignment and domain information

>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6	Back alignment and domain information

>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6	Back alignment and domain information

>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1	Back alignment and domain information

>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase	Back alignment and domain information

>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms]	Back alignment and domain information

>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase	Back alignment and domain information

>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha	Back alignment and domain information

>PTZ00267 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5	Back alignment and domain information

>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PTZ00266 NIMA-related protein kinase; Provisional	Back alignment and domain information

>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase	Back alignment and domain information

>KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]	Back alignment and domain information

>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase	Back alignment and domain information

>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3	Back alignment and domain information

>PTZ00283 serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PHA03210 serine/threonine kinase US3; Provisional	Back alignment and domain information

>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase	Back alignment and domain information

>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases	Back alignment and domain information

>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5	Back alignment and domain information

>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15	Back alignment and domain information

>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4	Back alignment and domain information

>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3	Back alignment and domain information

>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase	Back alignment and domain information

>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase	Back alignment and domain information

>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8	Back alignment and domain information

>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4	Back alignment and domain information

>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3	Back alignment and domain information

>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases	Back alignment and domain information

>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1	Back alignment and domain information

>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1	Back alignment and domain information

>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase	Back alignment and domain information

>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase	Back alignment and domain information

>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1	Back alignment and domain information

>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains	Back alignment and domain information

>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4	Back alignment and domain information

>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1	Back alignment and domain information

>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1	Back alignment and domain information

>KOG0586 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2	Back alignment and domain information

>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase	Back alignment and domain information

>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3	Back alignment and domain information

>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9	Back alignment and domain information

>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2	Back alignment and domain information

>KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification]	Back alignment and domain information

>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3	Back alignment and domain information

>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10	Back alignment and domain information

>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase	Back alignment and domain information

>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins	Back alignment and domain information

>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase	Back alignment and domain information

>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases	Back alignment and domain information

>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2	Back alignment and domain information

>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6	Back alignment and domain information

>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins	Back alignment and domain information

>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1	Back alignment and domain information

>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4	Back alignment and domain information

>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5	Back alignment and domain information

>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin	Back alignment and domain information

>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin	Back alignment and domain information

>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3	Back alignment and domain information

>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2	Back alignment and domain information

>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4	Back alignment and domain information

>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7	Back alignment and domain information

>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor	Back alignment and domain information

>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1	Back alignment and domain information

>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors	Back alignment and domain information

>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit	Back alignment and domain information

>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor	Back alignment and domain information

>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins	Back alignment and domain information

>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3	Back alignment and domain information

>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PHA02988 hypothetical protein; Provisional	Back alignment and domain information

>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1	Back alignment and domain information

>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases	Back alignment and domain information

>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2	Back alignment and domain information

>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6	Back alignment and domain information

>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5	Back alignment and domain information

>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3	Back alignment and domain information

>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1	Back alignment and domain information

>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2	Back alignment and domain information

>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase	Back alignment and domain information

>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]	Back alignment and domain information

>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional	Back alignment and domain information

>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]	Back alignment and domain information

>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases	Back alignment and domain information

>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase	Back alignment and domain information

>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase	Back alignment and domain information

>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1	Back alignment and domain information

>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase	Back alignment and domain information

>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1	Back alignment and domain information

>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase	Back alignment and domain information

>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein	Back alignment and domain information

>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor	Back alignment and domain information

>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases	Back alignment and domain information

>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors	Back alignment and domain information

>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta	Back alignment and domain information

>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11	Back alignment and domain information

>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes	Back alignment and domain information

>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor	Back alignment and domain information

>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase	Back alignment and domain information

>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6	Back alignment and domain information

>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase	Back alignment and domain information

>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1	Back alignment and domain information

>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors	Back alignment and domain information

>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains	Back alignment and domain information

>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases	Back alignment and domain information

>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase	Back alignment and domain information

>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors	Back alignment and domain information

>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2	Back alignment and domain information

>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase	Back alignment and domain information

>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2	Back alignment and domain information

>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4	Back alignment and domain information

>PRK13184 pknD serine/threonine-protein kinase; Reviewed	Back alignment and domain information

>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn	Back alignment and domain information

>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome	Back alignment and domain information

>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha	Back alignment and domain information

>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase	Back alignment and domain information

>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors	Back alignment and domain information

>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B	Back alignment and domain information

>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases	Back alignment and domain information

>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors	Back alignment and domain information

>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors	Back alignment and domain information

>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase	Back alignment and domain information

>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7	Back alignment and domain information

>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2	Back alignment and domain information

>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3	Back alignment and domain information

>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src	Back alignment and domain information

>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase	Back alignment and domain information

>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk	Back alignment and domain information

>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2	Back alignment and domain information

>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4	Back alignment and domain information

>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk	Back alignment and domain information

>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1	Back alignment and domain information

>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases	Back alignment and domain information

>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7	Back alignment and domain information

>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein	Back alignment and domain information

>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl	Back alignment and domain information

>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]	Back alignment and domain information

>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase	Back alignment and domain information

>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A	Back alignment and domain information

>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity	Back alignment and domain information

>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases	Back alignment and domain information

>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C	Back alignment and domain information

>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase	Back alignment and domain information

>smart00219 TyrKc Tyrosine kinase, catalytic domain	Back alignment and domain information

>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3	Back alignment and domain information

>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2	Back alignment and domain information

>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk	Back alignment and domain information

>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa	Back alignment and domain information

>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase	Back alignment and domain information

>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2	Back alignment and domain information

>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases	Back alignment and domain information

>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase)	Back alignment and domain information

>PLN03225 Serine/threonine-protein kinase SNT7; Provisional	Back alignment and domain information

>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer	Back alignment and domain information

>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]	Back alignment and domain information

>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta	Back alignment and domain information

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1	Back alignment and domain information

>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases	Back alignment and domain information

>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase	Back alignment and domain information

>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes	Back alignment and domain information

>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins	Back alignment and domain information

>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]	Back alignment and domain information

>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase	Back alignment and domain information

>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4	Back alignment and domain information

>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase	Back alignment and domain information

>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2	Back alignment and domain information

>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4	Back alignment and domain information

>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3	Back alignment and domain information

>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron	Back alignment and domain information

>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3	Back alignment and domain information

>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase	Back alignment and domain information

>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros	Back alignment and domain information

>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10	Back alignment and domain information

>PHA02882 putative serine/threonine kinase; Provisional	Back alignment and domain information

>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]	Back alignment and domain information

>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2	Back alignment and domain information

>KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]	Back alignment and domain information

>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases	Back alignment and domain information

>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3	Back alignment and domain information

>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]	Back alignment and domain information

>KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain	Back alignment and domain information

>PLN03224 probable serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms]	Back alignment and domain information

>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms]	Back alignment and domain information

>KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]	Back alignment and domain information

>KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms]	Back alignment and domain information

>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional	Back alignment and domain information

>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]	Back alignment and domain information

>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms]	Back alignment and domain information

>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]	Back alignment and domain information

>cd00180 PKc Catalytic domain of Protein Kinases	Back alignment and domain information

>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]	Back alignment and domain information

>smart00221 STYKc Protein kinase; unclassified specificity	Back alignment and domain information

>PLN00181 protein SPA1-RELATED; Provisional	Back alignment and domain information

>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>smart00750 KIND kinase non-catalytic C-lobe domain	Back alignment and domain information

>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]	Back alignment and domain information

>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK09188 serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms]	Back alignment and domain information

>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain	Back alignment and domain information

>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional	Back alignment and domain information

>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]	Back alignment and domain information

>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain	Back alignment and domain information

>PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A	Back alignment and domain information

>PRK12274 serine/threonine protein kinase; Provisional	Back alignment and domain information

>smart00090 RIO RIO-like kinase	Back alignment and domain information

>PRK10345 hypothetical protein; Provisional	Back alignment and domain information

>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK14879 serine/threonine protein kinase; Provisional	Back alignment and domain information

>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03724 arch_bud32 Kae1-associated kinase Bud32	Back alignment and domain information

>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain	Back alignment and domain information

>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated	Back alignment and domain information

>KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms]	Back alignment and domain information

>cd05119 RIO RIO kinase family, catalytic domain	Back alignment and domain information

>KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms]	Back alignment and domain information

>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed	Back alignment and domain information

>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family	Back alignment and domain information

>KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain	Back alignment and domain information

>KOG1243 consensus Protein kinase [General function prediction only]	Back alignment and domain information

>KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05151 ChoK Choline Kinase (ChoK)	Back alignment and domain information

>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed	Back alignment and domain information

>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase	Back alignment and domain information

>KOG1266 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>KOG3087 consensus Serine/threonine protein kinase [General function prediction only]	Back alignment and domain information

>KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification]	Back alignment and domain information

>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins	Back alignment and domain information

>PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>KOG2137 consensus Protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional	Back alignment and domain information

>COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms]	Back alignment and domain information

>PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases	Back alignment and domain information

>COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only]	Back alignment and domain information

>COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning]	Back alignment and domain information

>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]	Back alignment and domain information

>PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY)	Back alignment and domain information

>PRK09902 hypothetical protein; Provisional	Back alignment and domain information

>PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily	Back alignment and domain information

>TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172	Back alignment and domain information

>COG0661 AarF Predicted unusual protein kinase [General function prediction only]	Back alignment and domain information

>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02876 acyl-CoA dehydrogenase	Back alignment and domain information

>cd05150 APH Aminoglycoside 3'-phosphotransferase (APH)	Back alignment and domain information

>KOG1235 consensus Predicted unusual protein kinase [General function prediction only]	Back alignment and domain information

>PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2	Back alignment and domain information

>COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms]	Back alignment and domain information

>PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP	Back alignment and domain information

>PRK09550 mtnK methylthioribose kinase; Reviewed	Back alignment and domain information

>cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members	Back alignment and domain information

>KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning]	Back alignment and domain information

>cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes	Back alignment and domain information

>TIGR02721 ycfN_thiK thiamine kinase	Back alignment and domain information

>cd05153 HomoserineK_II Homoserine Kinase, type II	Back alignment and domain information

>TIGR00938 thrB_alt homoserine kinase, Neisseria type	Back alignment and domain information

>PRK05231 homoserine kinase; Provisional	Back alignment and domain information

>KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms]	Back alignment and domain information

>KOG1093 consensus Predicted protein kinase (contains TBC and RHOD domains) [General function prediction only]	Back alignment and domain information

>PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C)	Back alignment and domain information

>cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes	Back alignment and domain information

>TIGR01767 MTRK 5-methylthioribose kinase	Back alignment and domain information

>COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only]	Back alignment and domain information

>PRK12396 5-methylribose kinase; Reviewed	Back alignment and domain information

>TIGR02906 spore_CotS spore coat protein, CotS family	Back alignment and domain information

>PLN02236 choline kinase	Back alignment and domain information

>KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only]	Back alignment and domain information

>cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2')	Back alignment and domain information

>PLN02421 phosphotransferase, alcohol group as acceptor/kinase	Back alignment and domain information

>PLN02756 S-methyl-5-thioribose kinase	Back alignment and domain information

>PTZ00384 choline kinase; Provisional	Back alignment and domain information

>TIGR02904 spore_ysxE spore coat protein YsxE	Back alignment and domain information

>PRK10593 hypothetical protein; Provisional	Back alignment and domain information

>PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2	Back alignment and domain information

>COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning]	Back alignment and domain information

>KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK06148 hypothetical protein; Provisional	Back alignment and domain information

>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein []	Back alignment and domain information

>PTZ00296 choline kinase; Provisional	Back alignment and domain information

>KOG1236 consensus Predicted unusual protein kinase [General function prediction only]	Back alignment and domain information

>PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length	Back alignment and domain information

>PF02958 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 This family includes proteins of unknown function	Back alignment and domain information

Homologous Structure Templates