Citrus Sinensis ID: 014050

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-

MAPSVESSSAVTARGRLAVLTAHLASTESNQGRLIEPWCTSAQSMVPPPGNLKGSLTVVDERTGKRYQIPVSQEGTVKATDFKKITTGKNDKGLKLYDPGYLNTAPVRSSICYIDGDEGILRYRGYPIEELAESSSFLEVAYLLMYGNLPSESQLTDWEFAVSQHSAVPQGILDIIQAMPHDAHPMGVLVSAMSALSIFHPDANPALKGQDIYKSKQVRDKQIARILGKAPTIAAAAYLRMAGRPPVLPSNNLSYSENFLYMLDSLGNRAYKPNPRLARVLDVLFILHAEHEMNCSTSAARHLASSGVDVYTALAGAVGALYGPLHGGANEAVLKMLNEIGTVENIPEFIEGVKNRKRKMSGFGHRVYKNYDPRAKVIRKLAEEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRYE

ccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEccccCEEEEEECccccccccccccccccccccccCEEcccccccccEEEccEEEEccccEEEEccccHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccccccccccccccccccccc

*********************************************************VVDERTGKRYQIPVSQEGTVKATDFKKITTGKNDKGLKLYDPGYLNTAPVRSSICYIDGDEGILRYRGYPIEELAESSSFLEVAYLLMYGNLPSESQLTDWEFAVSQHSAVPQGILDIIQAMPHDAHPMGVLVSAMSALSIFHPDANPALKGQDIYKSKQVRDKQIARILGKAPTIAAAAYLRMAGRPPVLPSNNLSYSENFLYMLDSLGNRAYKPNPRLARVLDVLFILHAEHEMNCSTSAARHLASSGVDVYTALAGAVGALYGPLHGGANEAVLKMLNEIGTVENIPEFIEGVKNRKRKMSGFGHRVYKNYDPRAKVIRKLAEEVFSIVGRDPLIEVAVALEKAALSDEYFVKRKLYPNVDFYSGLIYRYE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Citrate synthase 2, peroxisomal	Peroxisomal citrate synthase required for the fatty acid respiration in seedlings, citrate being exported from peroxisomes into mitochondria during respiration of triacylglycerol (TAG). Indeed, complete respiration requires the transfer of carbon in the form of citrate from the peroxisome to the mitochondria.	confident	Q9LXS6
Citrate synthase, glyoxysomal		probable	P49299
Citrate synthase (Fragment)		probable	Q59730

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.3.-.-	Acyltransferases.	probable
2.3.3.-	Acyl groups converted into alkyl on transfer.	probable
2.3.3.1	Citrate (Si)-synthase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H12, chain A
Confidence level:very confident
Coverage over the Query: 54-201,217-430
View the alignment between query and template
View the model in PyMOL