Citrus Sinensis ID: 014094
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 431 | ||||||
| 449438283 | 425 | PREDICTED: DUF21 domain-containing prote | 0.986 | 1.0 | 0.860 | 0.0 | |
| 224056311 | 432 | predicted protein [Populus trichocarpa] | 0.986 | 0.983 | 0.832 | 0.0 | |
| 356524776 | 425 | PREDICTED: DUF21 domain-containing prote | 0.986 | 1.0 | 0.823 | 0.0 | |
| 357476069 | 425 | Metal transporter CNNM4 [Medicago trunca | 0.986 | 1.0 | 0.835 | 0.0 | |
| 359475517 | 430 | PREDICTED: DUF21 domain-containing prote | 0.993 | 0.995 | 0.833 | 0.0 | |
| 255562092 | 425 | conserved hypothetical protein [Ricinus | 0.983 | 0.997 | 0.835 | 0.0 | |
| 449478800 | 425 | PREDICTED: LOW QUALITY PROTEIN: DUF21 do | 0.979 | 0.992 | 0.834 | 0.0 | |
| 356521267 | 425 | PREDICTED: DUF21 domain-containing prote | 0.986 | 1.0 | 0.830 | 0.0 | |
| 224103813 | 430 | predicted protein [Populus trichocarpa] | 0.981 | 0.983 | 0.811 | 0.0 | |
| 356549461 | 423 | PREDICTED: DUF21 domain-containing prote | 0.981 | 1.0 | 0.823 | 0.0 |
| >gi|449438283|ref|XP_004136918.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Score = 762 bits (1968), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 371/431 (86%), Positives = 397/431 (92%), Gaps = 6/431 (1%)
Query: 1 MAVEYSCCGMGFIIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAA 60
MAVEY CC F IHI++IV LV+FAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDR HAA
Sbjct: 1 MAVEYECCTPNFFIHILIIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRIHAA 60
Query: 61 KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
KILPVV+NQHLLLCTLLICNAAAMEALPIFLD LV+AWGAILISVTLILLFGEIIPQSVC
Sbjct: 61 KILPVVKNQHLLLCTLLICNAAAMEALPIFLDSLVTAWGAILISVTLILLFGEIIPQSVC 120
Query: 121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
SRYGLAIG+TVAPFVRVLVWIC+PVA+PISKLLD LLGHGRVALFRRAELKTLVNLHGNE
Sbjct: 121 SRYGLAIGATVAPFVRVLVWICFPVAYPISKLLDFLLGHGRVALFRRAELKTLVNLHGNE 180
Query: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
AGKGGELTHDETTIIAGALEL+EKTA DAMTPI+ETFAIDINAKLD+ LMNL+LEKGHSR
Sbjct: 181 AGKGGELTHDETTIIAGALELSEKTAGDAMTPISETFAIDINAKLDRNLMNLVLEKGHSR 240
Query: 241 VPVYYEEPTNIIGLILVKNLLTIHPEDEVPVKSVTIRRIPRVPETLPLYEILNEFQKGHS 300
VPVYYEEPTNIIGLILVKNLLTIHP+DEVPVKSVTIRRIPRVPET+PLY+ILNEFQKGHS
Sbjct: 241 VPVYYEEPTNIIGLILVKNLLTIHPDDEVPVKSVTIRRIPRVPETMPLYDILNEFQKGHS 300
Query: 301 HMAVVVRQYNKNAEQPASNPASKSAYGSARDVKIDIDGEKPPQEKVLKTKRPLQKWKSFP 360
HMA+VV+Q NK K++ S +DV+ID+DGEKPPQEK LK KRPLQKWKSFP
Sbjct: 301 HMAIVVKQCNKM----NGKSDDKTSDDSQKDVRIDVDGEKPPQEKTLKNKRPLQKWKSFP 356
Query: 361 NSSNNNLYRTSSRSRKWTKDMYSDILQIDGNPLPKLPEEEEAVGVITMEDVIEELLQEEI 420
S NN +R+ SRS+KWTKDMYSDILQIDG+PLPKL EEEEAVGVITMEDVIEELLQEEI
Sbjct: 357 TS--NNSFRSGSRSKKWTKDMYSDILQIDGSPLPKLAEEEEAVGVITMEDVIEELLQEEI 414
Query: 421 FDETDHHFEDS 431
FDETDHHFEDS
Sbjct: 415 FDETDHHFEDS 425
|
Source: Cucumis sativus Species: Cucumis sativus Genus: Cucumis Family: Cucurbitaceae Order: Cucurbitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224056311|ref|XP_002298798.1| predicted protein [Populus trichocarpa] gi|222846056|gb|EEE83603.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356524776|ref|XP_003531004.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357476069|ref|XP_003608320.1| Metal transporter CNNM4 [Medicago truncatula] gi|355509375|gb|AES90517.1| Metal transporter CNNM4 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|359475517|ref|XP_002272975.2| PREDICTED: DUF21 domain-containing protein At2g14520-like [Vitis vinifera] gi|147815300|emb|CAN61244.1| hypothetical protein VITISV_016135 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255562092|ref|XP_002522054.1| conserved hypothetical protein [Ricinus communis] gi|223538653|gb|EEF40254.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449478800|ref|XP_004155421.1| PREDICTED: LOW QUALITY PROTEIN: DUF21 domain-containing protein At2g14520-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356521267|ref|XP_003529278.1| PREDICTED: DUF21 domain-containing protein At2g14520-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224103813|ref|XP_002313203.1| predicted protein [Populus trichocarpa] gi|222849611|gb|EEE87158.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|356549461|ref|XP_003543112.1| PREDICTED: DUF21 domain-containing protein At4g33700-like [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 431 | ||||||
| TAIR|locus:2055155 | 423 | AT2G14520 "AT2G14520" [Arabido | 0.979 | 0.997 | 0.734 | 3.9e-163 | |
| TAIR|locus:2134273 | 424 | AT4G33700 "AT4G33700" [Arabido | 0.979 | 0.995 | 0.722 | 6.5e-161 | |
| TAIR|locus:2203746 | 527 | AT1G47330 "AT1G47330" [Arabido | 0.990 | 0.810 | 0.507 | 2.1e-107 | |
| TAIR|locus:2129540 | 494 | AT4G14240 "AT4G14240" [Arabido | 0.640 | 0.558 | 0.620 | 1.6e-100 | |
| TAIR|locus:2149659 | 500 | AT5G52790 "AT5G52790" [Arabido | 0.672 | 0.58 | 0.6 | 3.2e-100 | |
| TAIR|locus:2129535 | 495 | AT4G14230 "AT4G14230" [Arabido | 0.640 | 0.557 | 0.592 | 3.3e-96 | |
| TAIR|locus:2014520 | 499 | AT1G03270 "AT1G03270" [Arabido | 0.856 | 0.739 | 0.494 | 1.1e-92 | |
| ASPGD|ASPL0000049101 | 716 | AN1876 [Emericella nidulans (t | 0.610 | 0.367 | 0.453 | 1.4e-62 | |
| ASPGD|ASPL0000052186 | 484 | AN0789 [Emericella nidulans (t | 0.672 | 0.599 | 0.427 | 3.7e-62 | |
| SGD|S000005421 | 706 | MAM3 "Protein required for nor | 0.614 | 0.375 | 0.4 | 9.9e-58 |
| TAIR|locus:2055155 AT2G14520 "AT2G14520" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1588 (564.1 bits), Expect = 3.9e-163, P = 3.9e-163
Identities = 316/430 (73%), Positives = 357/430 (83%)
Query: 1 MAVEYSCCGMGXXXXXXXXXXXXXXAXXXXXXXXXXXXXXXVDLEVLAKSGTPKDRKHAA 60
MAVEY CCG A VDLEVLAKSGTP+DR HAA
Sbjct: 1 MAVEYECCGTSFFIHIAVIVLLVLFAGLMSGLTLGLMSMSLVDLEVLAKSGTPRDRIHAA 60
Query: 61 KILPVVRNQHLLLCTLLICNAAAMEALPIFLDGLVSAWGAILISVTLILLFGEIIPQSVC 120
KILPVV+NQHLLLCTLLICNAAAMEALPIFLD LV+AWGAILISVTLILLFGEIIPQSVC
Sbjct: 61 KILPVVKNQHLLLCTLLICNAAAMEALPIFLDALVTAWGAILISVTLILLFGEIIPQSVC 120
Query: 121 SRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHGNE 180
SR+GLAIG+TVAPFVRVLVWIC PVA+PISKLLD LLGHGRVALFRRAELKTLV+LHGNE
Sbjct: 121 SRHGLAIGATVAPFVRVLVWICLPVAWPISKLLDFLLGHGRVALFRRAELKTLVDLHGNE 180
Query: 181 AGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSR 240
AGKGGELTHDETTIIAGALEL+EK A DAMTPI++TF IDINAKLD++LMNLIL+KGHSR
Sbjct: 181 AGKGGELTHDETTIIAGALELSEKMAKDAMTPISDTFVIDINAKLDRDLMNLILDKGHSR 240
Query: 241 VPVYYEEPTNIIGLILVKNLLTIHPEDEVPVKSVTIRRIPRVPETLPLYEILNEFQKGHS 300
VPVYYE+ TNIIGL+LVKNLLTI+P++E+ VK+VTIRRIPRVPETLPLY+ILNEFQKGHS
Sbjct: 241 VPVYYEQRTNIIGLVLVKNLLTINPDEEIQVKNVTIRRIPRVPETLPLYDILNEFQKGHS 300
Query: 301 HMAVVVRQYNKNAEQPASNPASKSAYGSARDVKIDIDGEKPPQEKVLKTKRPLQKWKSFP 360
HMAVVVRQ +K SN A+ + +V++D+D E+ PQE LK +R LQKWKSFP
Sbjct: 301 HMAVVVRQCDK-IHPLQSNDAANE---TVNEVRVDVDYERSPQETKLKRRRSLQKWKSFP 356
Query: 361 NSSNNNLYRTSSRSRKWTKDMYSDILQIDGNPLPKLPEEEEAVGVITMEDVIEELLQEEI 420
N +N+ SRS++W+KD +DILQ++ +PLPKL EEE+AVG+ITMEDVIEELLQEEI
Sbjct: 357 NRANS----LGSRSKRWSKDNDADILQLNEHPLPKLDEEEDAVGIITMEDVIEELLQEEI 412
Query: 421 FDETDHHFED 430
FDETDHHFED
Sbjct: 413 FDETDHHFED 422
|
|
| TAIR|locus:2134273 AT4G33700 "AT4G33700" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2203746 AT1G47330 "AT1G47330" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129540 AT4G14240 "AT4G14240" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149659 AT5G52790 "AT5G52790" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129535 AT4G14230 "AT4G14230" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2014520 AT1G03270 "AT1G03270" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000049101 AN1876 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000052186 AN0789 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| SGD|S000005421 MAM3 "Protein required for normal mitochondrial morphology" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 431 | |||
| COG1253 | 429 | COG1253, TlyC, Hemolysins and related proteins con | 2e-56 | |
| pfam01595 | 182 | pfam01595, DUF21, Domain of unknown function DUF21 | 9e-36 | |
| COG4536 | 423 | COG4536, CorB, Putative Mg2+ and Co2+ transporter | 8e-33 | |
| TIGR03520 | 408 | TIGR03520, GldE, gliding motility-associated prote | 6e-24 | |
| cd04590 | 111 | cd04590, CBS_pair_CorC_HlyC_assoc, This cd contain | 4e-22 | |
| COG4535 | 293 | COG4535, CorC, Putative Mg2+ and Co2+ transporter | 3e-16 | |
| PRK15094 | 292 | PRK15094, PRK15094, magnesium/cobalt efflux protei | 5e-11 | |
| PRK11573 | 413 | PRK11573, PRK11573, hypothetical protein; Provisio | 1e-08 |
| >gnl|CDD|224173 COG1253, TlyC, Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
Score = 191 bits (488), Expect = 2e-56
Identities = 88/313 (28%), Positives = 157/313 (50%), Gaps = 21/313 (6%)
Query: 13 IIHIVVIVFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLL 72
I+ +++I+ L+ + S L+S+ LE LA+ G + A L ++ +
Sbjct: 4 ILTLLLILLLIALSAFFSAAEFALVSLRRSRLEQLAEEGNKR----AKAALKLIERLNRY 59
Query: 73 LCTLLICN-----------AAAMEAL--PIFLDGLVSAWGAILISVTLILLFGEIIPQSV 119
L T+ + A+ AL P+ +SA + I L ++FGE++P+S+
Sbjct: 60 LSTVQLGITLVSLLLGAVGEPALAALLEPLLEALGLSAALSFAIITFLHVVFGELVPKSI 119
Query: 120 CSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLLGHGRVALFRRAELKTLVNLHG- 178
R + +AP +R + YP+ + ++++ + +L V L +
Sbjct: 120 AIRNPEKVALLIAPPLRFFYRLLYPLIWLLNRIANAILRLFGVEPVEEEALTSTEEELEL 179
Query: 179 -NEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKG 237
+E+ + G L +E +I L+L ++T + MTP + A+D+ ++ EL+ LILE G
Sbjct: 180 VSESAEEGVLEEEEREMINNVLDLDDRTVREIMTPRTDIVALDLTDTVE-ELIELILESG 238
Query: 238 HSRVPVYYEEPTNIIGLILVKNLLTIHPEDE-VPVKSVTIRRIPRVPETLPLYEILNEFQ 296
HSR+PVY + NIIG++ VK+LL + + V +R VPETL L ++L EF+
Sbjct: 239 HSRIPVYDGDLDNIIGIVHVKDLLRALLDGQSDLDLRVLVRPPLFVPETLSLSDLLEEFR 298
Query: 297 KGHSHMAVVVRQY 309
+ +HMA+VV +Y
Sbjct: 299 EERTHMAIVVDEY 311
|
Length = 429 |
| >gnl|CDD|216595 pfam01595, DUF21, Domain of unknown function DUF21 | Back alignment and domain information |
|---|
| >gnl|CDD|226911 COG4536, CorB, Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|132559 TIGR03520, GldE, gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >gnl|CDD|239963 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >gnl|CDD|226910 COG4535, CorC, Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|185050 PRK15094, PRK15094, magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236933 PRK11573, PRK11573, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 100.0 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 100.0 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 100.0 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 100.0 | |
| KOG2118 | 498 | consensus Predicted membrane protein, contains two | 99.97 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 99.96 | |
| PF01595 | 183 | DUF21: Domain of unknown function DUF21; InterPro: | 99.95 | |
| COG4535 | 293 | CorC Putative Mg2+ and Co2+ transporter CorC [Inor | 99.95 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 99.7 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 99.7 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 99.68 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 99.64 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 99.6 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 99.51 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 99.5 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 99.48 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 99.46 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 99.45 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 99.45 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 99.45 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 99.43 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 99.43 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 99.42 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 99.42 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 99.42 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 99.42 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 99.42 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 99.41 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 99.41 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 99.4 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 99.4 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 99.4 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 99.39 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 99.38 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 99.37 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 99.37 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 99.37 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 99.36 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 99.36 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 99.36 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 99.36 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 99.36 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 99.35 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 99.35 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 99.35 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 99.35 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 99.35 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 99.35 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 99.35 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 99.35 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 99.35 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 99.34 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 99.34 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 99.34 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 99.34 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 99.33 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 99.33 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 99.33 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 99.33 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 99.32 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 99.32 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 99.32 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 99.32 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 99.32 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 99.32 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 99.31 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 99.31 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 99.31 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 99.3 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 99.3 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 99.3 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 99.3 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 99.3 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 99.29 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 99.29 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 99.29 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 99.29 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 99.28 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 99.28 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.28 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 99.28 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 99.26 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 99.26 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 99.25 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 99.24 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 99.2 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 99.2 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 99.2 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 99.19 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 99.18 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 99.07 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 98.99 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 98.92 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.68 | |
| PF00571 | 57 | CBS: CBS domain CBS domain web page. Mutations in | 98.61 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.47 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 98.44 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 98.43 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.3 | |
| KOG0474 | 762 | consensus Cl- channel CLC-7 and related proteins ( | 98.27 | |
| TIGR00400 | 449 | mgtE Mg2+ transporter (mgtE). This family of proka | 97.93 | |
| COG2524 | 294 | Predicted transcriptional regulator, contains C-te | 97.85 | |
| cd04603 | 111 | CBS_pair_KefB_assoc This cd contains two tandem re | 97.85 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 97.83 | |
| cd04617 | 118 | CBS_pair_4 The CBS domain, named after human CBS, | 97.74 | |
| cd04604 | 114 | CBS_pair_KpsF_GutQ_assoc This cd contains two tand | 97.72 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.7 | |
| cd04801 | 114 | CBS_pair_M50_like This cd contains two tandem repe | 97.63 | |
| cd04619 | 114 | CBS_pair_6 The CBS domain, named after human CBS, | 97.61 | |
| cd04597 | 113 | CBS_pair_DRTGG_assoc2 This cd contains two tandem | 97.61 | |
| PRK14869 | 546 | putative manganese-dependent inorganic pyrophospha | 97.61 | |
| cd04618 | 98 | CBS_pair_5 The CBS domain, named after human CBS, | 97.57 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 97.53 | |
| COG3448 | 382 | CBS-domain-containing membrane protein [Signal tra | 97.53 | |
| TIGR03520 | 408 | GldE gliding motility-associated protein GldE. Mem | 97.49 | |
| cd04607 | 113 | CBS_pair_NTP_transferase_assoc This cd contains tw | 97.47 | |
| cd04640 | 126 | CBS_pair_27 The CBS domain, named after human CBS, | 97.47 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 97.46 | |
| cd04585 | 122 | CBS_pair_ACT_assoc2 This cd contains two tandem re | 97.44 | |
| KOG0475 | 696 | consensus Cl- channel CLC-3 and related proteins ( | 97.43 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 97.43 | |
| cd04623 | 113 | CBS_pair_10 The CBS domain, named after human CBS, | 97.4 | |
| cd04600 | 124 | CBS_pair_HPP_assoc This cd contains two tandem rep | 97.38 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 97.38 | |
| cd04627 | 123 | CBS_pair_14 The CBS domain, named after human CBS, | 97.37 | |
| cd04625 | 112 | CBS_pair_12 The CBS domain, named after human CBS, | 97.36 | |
| cd04610 | 107 | CBS_pair_ParBc_assoc This cd contains two tandem r | 97.35 | |
| cd04630 | 114 | CBS_pair_17 The CBS domain, named after human CBS, | 97.35 | |
| cd04620 | 115 | CBS_pair_7 The CBS domain, named after human CBS, | 97.34 | |
| cd04582 | 106 | CBS_pair_ABC_OpuCA_assoc This cd contains two tand | 97.33 | |
| cd04613 | 114 | CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two | 97.3 | |
| cd04621 | 135 | CBS_pair_8 The CBS domain, named after human CBS, | 97.29 | |
| cd04596 | 108 | CBS_pair_DRTGG_assoc This cd contains two tandem r | 97.29 | |
| cd04615 | 113 | CBS_pair_2 The CBS domain, named after human CBS, | 97.28 | |
| cd04626 | 111 | CBS_pair_13 The CBS domain, named after human CBS, | 97.27 | |
| cd04593 | 115 | CBS_pair_EriC_assoc_bac_arch This cd contains two | 97.27 | |
| COG0517 | 117 | FOG: CBS domain [General function prediction only] | 97.27 | |
| PRK10892 | 326 | D-arabinose 5-phosphate isomerase; Provisional | 97.27 | |
| cd04633 | 121 | CBS_pair_20 The CBS domain, named after human CBS, | 97.26 | |
| KOG1764 | 381 | consensus 5'-AMP-activated protein kinase, gamma s | 97.26 | |
| cd04636 | 132 | CBS_pair_23 The CBS domain, named after human CBS, | 97.25 | |
| cd04595 | 110 | CBS_pair_DHH_polyA_Pol_assoc This cd contains two | 97.23 | |
| cd04589 | 111 | CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains | 97.22 | |
| cd04599 | 105 | CBS_pair_GGDEF_assoc2 This cd contains two tandem | 97.21 | |
| cd04622 | 113 | CBS_pair_9 The CBS domain, named after human CBS, | 97.21 | |
| cd04641 | 120 | CBS_pair_28 The CBS domain, named after human CBS, | 97.19 | |
| cd04631 | 125 | CBS_pair_18 The CBS domain, named after human CBS, | 97.19 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.19 | |
| COG3620 | 187 | Predicted transcriptional regulator with C-termina | 97.19 | |
| cd04587 | 113 | CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains | 97.18 | |
| cd04584 | 121 | CBS_pair_ACT_assoc This cd contains two tandem rep | 97.18 | |
| cd04629 | 114 | CBS_pair_16 The CBS domain, named after human CBS, | 97.17 | |
| cd04586 | 135 | CBS_pair_BON_assoc This cd contains two tandem rep | 97.17 | |
| cd04800 | 111 | CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains | 97.16 | |
| cd04594 | 104 | CBS_pair_EriC_assoc_archaea This cd contains two t | 97.16 | |
| PRK11543 | 321 | gutQ D-arabinose 5-phosphate isomerase; Provisiona | 97.15 | |
| cd04601 | 110 | CBS_pair_IMPDH This cd contains two tandem repeats | 97.15 | |
| cd04803 | 122 | CBS_pair_15 The CBS domain, named after human CBS, | 97.14 | |
| cd04802 | 112 | CBS_pair_3 The CBS domain, named after human CBS, | 97.13 | |
| cd04611 | 111 | CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two | 97.13 | |
| cd04612 | 111 | CBS_pair_SpoIVFB_EriC_assoc This cd contains two t | 97.13 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 97.13 | |
| cd04583 | 109 | CBS_pair_ABC_OpuCA_assoc2 This cd contains two tan | 97.12 | |
| cd04602 | 114 | CBS_pair_IMPDH_2 This cd contains two tandem repea | 97.11 | |
| cd04635 | 122 | CBS_pair_22 The CBS domain, named after human CBS, | 97.09 | |
| cd04606 | 109 | CBS_pair_Mg_transporter This cd contains two tande | 97.09 | |
| cd04639 | 111 | CBS_pair_26 The CBS domain, named after human CBS, | 97.09 | |
| cd04643 | 116 | CBS_pair_30 The CBS domain, named after human CBS, | 97.05 | |
| smart00116 | 49 | CBS Domain in cystathionine beta-synthase and othe | 97.03 | |
| cd04632 | 128 | CBS_pair_19 The CBS domain, named after human CBS, | 96.99 | |
| cd04637 | 122 | CBS_pair_24 The CBS domain, named after human CBS, | 96.97 | |
| cd04592 | 133 | CBS_pair_EriC_assoc_euk This cd contains two tande | 96.96 | |
| cd04642 | 126 | CBS_pair_29 The CBS domain, named after human CBS, | 96.94 | |
| cd04614 | 96 | CBS_pair_1 The CBS domain, named after human CBS, | 96.94 | |
| cd04605 | 110 | CBS_pair_MET2_assoc This cd contains two tandem re | 96.93 | |
| cd04624 | 112 | CBS_pair_11 The CBS domain, named after human CBS, | 96.89 | |
| TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 96.87 | |
| cd04608 | 124 | CBS_pair_PALP_assoc This cd contains two tandem re | 96.83 | |
| cd04588 | 110 | CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains | 96.83 | |
| cd04590 | 111 | CBS_pair_CorC_HlyC_assoc This cd contains two tand | 96.78 | |
| PRK01862 | 574 | putative voltage-gated ClC-type chloride channel C | 96.77 | |
| cd04591 | 105 | CBS_pair_EriC_assoc_euk_bac This cd contains two t | 96.74 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 96.71 | |
| cd04634 | 143 | CBS_pair_21 The CBS domain, named after human CBS, | 96.7 | |
| cd04598 | 119 | CBS_pair_GGDEF_assoc This cd contains two tandem r | 96.6 | |
| TIGR00393 | 268 | kpsF KpsF/GutQ family protein. This model describe | 96.56 | |
| COG2905 | 610 | Predicted signal-transduction protein containing c | 96.54 | |
| PRK15094 | 292 | magnesium/cobalt efflux protein CorC; Provisional | 96.48 | |
| COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 96.42 | |
| cd04638 | 106 | CBS_pair_25 The CBS domain, named after human CBS, | 96.41 | |
| cd02205 | 113 | CBS_pair The CBS domain, named after human CBS, is | 96.25 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 96.21 | |
| cd04609 | 110 | CBS_pair_PALP_assoc2 This cd contains two tandem r | 96.17 | |
| COG2239 | 451 | MgtE Mg/Co/Ni transporter MgtE (contains CBS domai | 95.4 | |
| KOG2550 | 503 | consensus IMP dehydrogenase/GMP reductase [Nucleot | 94.9 | |
| COG4109 | 432 | Predicted transcriptional regulator containing CBS | 93.81 | |
| KOG0476 | 931 | consensus Cl- channel CLC-2 and related proteins ( | 93.34 | |
| PRK11573 | 413 | hypothetical protein; Provisional | 93.22 | |
| TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 92.85 | |
| PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 90.05 | |
| COG1253 | 429 | TlyC Hemolysins and related proteins containing CB | 89.91 | |
| COG4536 | 423 | CorB Putative Mg2+ and Co2+ transporter CorB [Inor | 84.02 | |
| COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 82.0 |
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-59 Score=481.12 Aligned_cols=280 Identities=27% Similarity=0.478 Sum_probs=242.3
Q ss_pred HHHHHHHHHHHHHHHHHHhcCHHHHHHHHHcCChhhHHHHHHHhHHHHcchhhHHHHHHHHHHHHHHHHHHHh----hHH
Q 014094 20 VFLVMFAGLMSGLTLGLMSMSLVDLEVLAKSGTPKDRKHAAKILPVVRNQHLLLCTLLICNAAAMEALPIFLD----GLV 95 (431)
Q Consensus 20 ~~lillsafFs~~E~Al~S~~r~rL~~l~~~g~~~~~~~a~~il~l~~~~~~ll~tilign~~~~~~~~~~~~----~~~ 95 (431)
++|+++||||||+|+|++|+++.||++++++|+++ |+++++++++|+++++|+++||+++|.+.+.++. .++
T Consensus 2 ~~li~lsa~Fs~~E~Al~s~~~~~l~~l~~~~~~~----a~~~~~l~~~~~~~L~tiligntl~ni~~~~~~~~~~~~~~ 77 (408)
T TIGR03520 2 ILLLLLSALVSGSEVAFFSLSPTDLNDEEEDNSKK----EQIVINLLDRPKKLLATILIANNFINIAIVLLFTSLSDNLF 77 (408)
T ss_pred hHHHHHHHHHHHHHHHHHhcCHHHHHHHHHcCCHH----HHHHHHHHhChHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence 46789999999999999999999999999998753 6678899999999999999999999876544322 222
Q ss_pred H--------HHHHHHHHHHHHHHHhhhchHHHHHHhhHHHHhhhhHHHHHHHHHhhhhHHHHHHHHHhHh---cCCCccc
Q 014094 96 S--------AWGAILISVTLILLFGEIIPQSVCSRYGLAIGSTVAPFVRVLVWICYPVAFPISKLLDVLL---GHGRVAL 164 (431)
Q Consensus 96 ~--------~~~a~~i~t~lilvfGEiiPK~la~~~p~~ia~~~a~~l~~~~~l~~Plv~~l~~~~~~ll---g~~~~~~ 164 (431)
+ ...+++++|+++++|||++||++|.+||+++++++++|+++++++|+|++|++++++++++ |.+. ..
T Consensus 78 ~~~~~~~~~~~~~~~~~t~l~lvfgEiiPK~la~~~~~~ia~~~a~~l~~~~~l~~P~~~~l~~~~~~i~~~~g~~~-~~ 156 (408)
T TIGR03520 78 GSFNTELLRFLIEVVIVTFLILLFGEILPKVYANRNNLKFAKFMAYPINILDKVFSPISLPLRAITNFIHKKFGKQK-SN 156 (408)
T ss_pred hhccchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC-CC
Confidence 1 1123445677899999999999999999999999999999999999999999999877654 5443 35
Q ss_pred cCHHHHHHHHHhcccccccCCCCCHHHHHHHHHhhcccccccccccccCcceEEEeCCCChHHHHHHHHHhcCCceeeee
Q 014094 165 FRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVY 244 (431)
Q Consensus 165 ~s~eEL~~lv~~~~~e~~~~G~L~~~E~~~i~~~l~l~~~tV~dIMtpr~~vvtv~~d~tv~~ea~~~m~~~~~sriPV~ 244 (431)
+|+|||+.+++. +.++| ++++|+++++|+++|++++|+|+|+||.++++++.+++++ ++.+.+.+++|||+|||
T Consensus 157 ~t~eEl~~lv~~----~~~~g-~~~~E~~~i~~vl~l~~~~v~diMtpr~~v~~l~~~~~~~-e~~~~~~~~~~sR~PV~ 230 (408)
T TIGR03520 157 ISVDQLSQALEL----TDEED-TTKEEQKILQGIVSFGNTDTKQVMRPRLDIFALDIETSFS-EIIPKIIENGYSRIPVY 230 (408)
T ss_pred CCHHHHHHHHHh----HhhcC-CChHHHHHHHHHhccCCCEeeeeCCchHhEEEEECCCCHH-HHHHHHHhCCCCEEEEE
Confidence 799999999973 33446 6899999999999999999999999999999999999998 99999999999999999
Q ss_pred eCCCCcEEEEEEhhhhhccCCCCcccccccccCCCceecCCCCHHHHHHHHHhCCCeEEEEEecCCC
Q 014094 245 YEEPTNIIGLILVKNLLTIHPEDEVPVKSVTIRRIPRVPETLPLYEILNEFQKGHSHMAVVVRQYNK 311 (431)
Q Consensus 245 d~~~~~ivGIV~~kDLl~~~~~~~~~V~dim~r~v~~V~~~~~l~~aL~~m~~~~~~~a~VVDEyG~ 311 (431)
+++.|+++|+|+.||++....++..++.++ ++++.+||+++++.++++.|++++.|+++|+||||+
T Consensus 231 ~~~~d~ivGiv~~kDll~~~~~~~~~l~~~-~~~~~~Vpe~~~l~~ll~~m~~~~~~~aiVvDE~G~ 296 (408)
T TIGR03520 231 KETIDNITGVLYIKDLLPHLNKKNFDWQSL-LREPYFVPENKKLDDLLRDFQEKKNHLAIVVDEYGG 296 (408)
T ss_pred cCCCCceEEEEEHHHHHhHhccCCCCHHHH-cCCCeEeCCCCcHHHHHHHHHhcCceEEEEEcCCCC
Confidence 977789999999999986543333457787 578999999999999999999999999999997665
|
Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldC is a protein linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. GldE was discovered because of its adjacency to GldD in F. johnsonii. Overexpression of GldE partially supresses the effects of a GldB point mutant suggesting that GldB and GldE interact. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Not all Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility and in fact some do not appear to express the gliding phenotype. |
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2118 consensus Predicted membrane protein, contains two CBS domains [Function unknown] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >PF01595 DUF21: Domain of unknown function DUF21; InterPro: IPR002550 This transmembrane region has no known function | Back alignment and domain information |
|---|
| >COG4535 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PF00571 CBS: CBS domain CBS domain web page | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >KOG0474 consensus Cl- channel CLC-7 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00400 mgtE Mg2+ transporter (mgtE) | Back alignment and domain information |
|---|
| >COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04603 CBS_pair_KefB_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04617 CBS_pair_4 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04604 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04801 CBS_pair_M50_like This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 | Back alignment and domain information |
|---|
| >cd04619 CBS_pair_6 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04597 CBS_pair_DRTGG_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >PRK14869 putative manganese-dependent inorganic pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >cd04618 CBS_pair_5 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG3448 CBS-domain-containing membrane protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR03520 GldE gliding motility-associated protein GldE | Back alignment and domain information |
|---|
| >cd04607 CBS_pair_NTP_transferase_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream | Back alignment and domain information |
|---|
| >cd04640 CBS_pair_27 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >cd04585 CBS_pair_ACT_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >KOG0475 consensus Cl- channel CLC-3 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd04623 CBS_pair_10 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04600 CBS_pair_HPP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04627 CBS_pair_14 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04625 CBS_pair_12 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04610 CBS_pair_ParBc_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream | Back alignment and domain information |
|---|
| >cd04630 CBS_pair_17 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04620 CBS_pair_7 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04582 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04613 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >cd04621 CBS_pair_8 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04596 CBS_pair_DRTGG_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream | Back alignment and domain information |
|---|
| >cd04615 CBS_pair_2 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04626 CBS_pair_13 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04593 CBS_pair_EriC_assoc_bac_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in bacteria and archaea | Back alignment and domain information |
|---|
| >COG0517 FOG: CBS domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10892 D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04633 CBS_pair_20 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >KOG1764 consensus 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd04636 CBS_pair_23 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04595 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain | Back alignment and domain information |
|---|
| >cd04589 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04599 CBS_pair_GGDEF_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >cd04622 CBS_pair_9 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04641 CBS_pair_28 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04631 CBS_pair_18 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >COG3620 Predicted transcriptional regulator with C-terminal CBS domains [Transcription] | Back alignment and domain information |
|---|
| >cd04587 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04584 CBS_pair_ACT_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria | Back alignment and domain information |
|---|
| >cd04629 CBS_pair_16 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04586 CBS_pair_BON_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain | Back alignment and domain information |
|---|
| >cd04800 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain | Back alignment and domain information |
|---|
| >cd04594 CBS_pair_EriC_assoc_archaea This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the EriC CIC-type chloride channels in archaea | Back alignment and domain information |
|---|
| >PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04601 CBS_pair_IMPDH This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04803 CBS_pair_15 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04802 CBS_pair_3 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04611 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream | Back alignment and domain information |
|---|
| >cd04612 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >cd04583 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA | Back alignment and domain information |
|---|
| >cd04602 CBS_pair_IMPDH_2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein | Back alignment and domain information |
|---|
| >cd04635 CBS_pair_22 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04606 CBS_pair_Mg_transporter This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE | Back alignment and domain information |
|---|
| >cd04639 CBS_pair_26 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04643 CBS_pair_30 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >smart00116 CBS Domain in cystathionine beta-synthase and other proteins | Back alignment and domain information |
|---|
| >cd04632 CBS_pair_19 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04637 CBS_pair_24 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04592 CBS_pair_EriC_assoc_euk This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes | Back alignment and domain information |
|---|
| >cd04642 CBS_pair_29 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04614 CBS_pair_1 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04605 CBS_pair_MET2_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain | Back alignment and domain information |
|---|
| >cd04624 CBS_pair_11 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
|---|
| >cd04608 CBS_pair_PALP_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >cd04588 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain | Back alignment and domain information |
|---|
| >cd04590 CBS_pair_CorC_HlyC_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain | Back alignment and domain information |
|---|
| >PRK01862 putative voltage-gated ClC-type chloride channel ClcB; Provisional | Back alignment and domain information |
|---|
| >cd04591 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes and bacteria | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >cd04634 CBS_pair_21 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd04598 CBS_pair_GGDEF_assoc This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain | Back alignment and domain information |
|---|
| >TIGR00393 kpsF KpsF/GutQ family protein | Back alignment and domain information |
|---|
| >COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15094 magnesium/cobalt efflux protein CorC; Provisional | Back alignment and domain information |
|---|
| >COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd04638 CBS_pair_25 The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >cd02205 CBS_pair The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd04609 CBS_pair_PALP_assoc2 This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream | Back alignment and domain information |
|---|
| >COG2239 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2550 consensus IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG4109 Predicted transcriptional regulator containing CBS domains [Transcription] | Back alignment and domain information |
|---|
| >KOG0476 consensus Cl- channel CLC-2 and related proteins (CLC superfamily) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11573 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >COG1253 TlyC Hemolysins and related proteins containing CBS domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG4536 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 431 | ||||
| 3jtf_A | 129 | The Cbs Domain Pair Structure Of A Magnesium And Co | 5e-10 | ||
| 4hg0_A | 292 | Crystal Structure Of Magnesium And Cobalt Efflux Pr | 1e-08 | ||
| 3lhh_A | 172 | The Crystal Structure Of Cbs Domain Protein From Sh | 2e-06 | ||
| 3nqr_A | 127 | A Putative Cbs Domain-Containing Protein From Salmo | 5e-06 | ||
| 3lfr_A | 136 | The Crystal Structure Of A Cbs Domain From A Putati | 1e-05 | ||
| 3oi8_A | 156 | The Crystal Structure Of Functionally Unknown Conse | 1e-04 |
| >pdb|3JTF|A Chain A, The Cbs Domain Pair Structure Of A Magnesium And Cobalt Efflux Protein From Bordetella Parapertussis In Complex With Amp Length = 129 | Back alignment and structure |
|
| >pdb|4HG0|A Chain A, Crystal Structure Of Magnesium And Cobalt Efflux Protein Corc, Northeast Structural Genomics Consortium (nesg) Target Er40 Length = 292 | Back alignment and structure |
| >pdb|3LHH|A Chain A, The Crystal Structure Of Cbs Domain Protein From Shewanella Oneidensis Mr-1 Length = 172 | Back alignment and structure |
| >pdb|3NQR|A Chain A, A Putative Cbs Domain-Containing Protein From Salmonella Typhimurium Lt2 Length = 127 | Back alignment and structure |
| >pdb|3LFR|A Chain A, The Crystal Structure Of A Cbs Domain From A Putative Metal Ion Transporter Bound To Amp From Pseudomonas Syringae To 1.55a Length = 136 | Back alignment and structure |
| >pdb|3OI8|A Chain A, The Crystal Structure Of Functionally Unknown Conserved Protein Domain From Neisseria Meningitidis Mc58 Length = 156 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 431 | |||
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 6e-34 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 1e-33 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 1e-32 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 2e-31 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 3e-31 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 3e-28 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 6e-28 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 8e-27 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 2e-26 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 4e-26 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-07 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 4e-06 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 2e-05 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 5e-05 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 6e-05 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 1e-04 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 9e-04 |
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} Length = 156 | Back alignment and structure |
|---|
Score = 123 bits (311), Expect = 6e-34
Identities = 32/141 (22%), Positives = 67/141 (47%), Gaps = 7/141 (4%)
Query: 167 RAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLD 226
++ L+ +A + D + L+ ++ DAM + + N ++
Sbjct: 5 AEDVLNLLR----QAHEQEVFDADTLLRLEKVLDFSDLEVRDAMITRSRMNVLKENDSIE 60
Query: 227 KELMNLILEKGHSRVPVYYEEPTNIIGLILVKNLLT-IHPEDEVPVKSVTIRRIPRVPET 285
+ +++ HSR PV E+ ++G++ K+LL + ++ +KS+ +R VPE
Sbjct: 61 -RITAYVIDTAHSRFPVIGEDKDEVLGILHAKDLLKYMFNPEQFHLKSI-LRPAVFVPEG 118
Query: 286 LPLYEILNEFQKGHSHMAVVV 306
L +L EF++ +HMA+V+
Sbjct: 119 KSLTALLKEFREQRNHMAIVI 139
|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} Length = 172 | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} Length = 148 | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} Length = 173 | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} Length = 153 | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} Length = 129 | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} Length = 130 | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} Length = 130 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} Length = 136 | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} Length = 127 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 Length = 159 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} Length = 157 | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} Length = 150 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 Length = 296 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 99.95 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 99.94 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 99.93 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 99.91 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 99.9 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 99.87 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 99.86 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 99.85 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 99.85 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 99.85 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 99.85 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 99.84 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 99.83 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 99.8 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 99.79 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 99.76 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 99.75 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 99.74 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 99.74 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 99.74 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 99.74 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 99.74 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 99.72 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 99.72 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.72 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 99.72 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 99.72 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 99.72 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 99.71 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 99.7 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 99.7 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 99.69 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 99.69 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 99.69 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 99.69 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 99.69 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 99.69 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 99.68 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.68 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 99.67 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.67 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 99.67 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 99.66 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 99.66 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 99.64 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 99.62 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 99.62 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 99.61 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.6 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.6 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 99.58 | |
| 3kh5_A | 280 | Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, a | 99.58 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 99.57 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 99.56 | |
| 3t4n_C | 323 | Nuclear protein SNF4; CBS domain, nucleotide bindi | 99.56 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.55 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 99.55 | |
| 3ddj_A | 296 | CBS domain-containing protein; structural genomics | 99.55 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.54 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 99.52 | |
| 2yzq_A | 282 | Putative uncharacterized protein PH1780; sheet/hel | 99.51 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 99.48 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.48 | |
| 2qrd_G | 334 | Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, | 99.47 | |
| 2v8q_E | 330 | 5'-AMP-activated protein kinase subunit gamma-1; p | 99.42 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 99.29 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 99.23 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 99.17 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.82 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.64 | |
| 1vr9_A | 213 | CBS domain protein/ACT domain protein; structural | 98.56 | |
| 4esy_A | 170 | CBS domain containing membrane protein; structural | 98.34 | |
| 3l2b_A | 245 | Probable manganase-dependent inorganic pyrophospha | 98.23 | |
| 3ghd_A | 70 | A cystathionine beta-synthase domain protein FUSE | 98.23 | |
| 4fry_A | 157 | Putative signal-transduction protein with CBS DOM; | 98.09 | |
| 3kpb_A | 122 | Uncharacterized protein MJ0100; CBS domain, S-aden | 98.08 | |
| 3fv6_A | 159 | YQZB protein; CBS domain dimer, metabolism regulat | 98.07 | |
| 3fio_A | 70 | A cystathionine beta-synthase domain protein fused | 98.05 | |
| 1pbj_A | 125 | Hypothetical protein; structural genomics, domain, | 98.02 | |
| 3gby_A | 128 | Uncharacterized protein CT1051; CBS domain, struct | 98.01 | |
| 3k2v_A | 149 | Putative D-arabinose 5-phosphate isomerase; KPSF-l | 98.01 | |
| 2yzi_A | 138 | Hypothetical protein PH0107; sheet/helix/sheet/she | 98.01 | |
| 3lhh_A | 172 | CBS domain protein; structural genomics, PSI-2, pr | 98.0 | |
| 2rc3_A | 135 | CBS domain; in SITU proteolysis, BR, structural ge | 97.97 | |
| 2ef7_A | 133 | Hypothetical protein ST2348; CBS-domain, structura | 97.97 | |
| 3lfr_A | 136 | Putative metal ION transporter; CBS, AMP, PSI, MCS | 97.97 | |
| 3lv9_A | 148 | Putative transporter; CBS domain, PSI, MCSG, struc | 97.97 | |
| 1pvm_A | 184 | Conserved hypothetical protein TA0289; structural | 97.96 | |
| 3oco_A | 153 | Hemolysin-like protein containing CBS domains; str | 97.96 | |
| 4gqw_A | 152 | CBS domain-containing protein CBSX1, chloroplasti; | 97.96 | |
| 2rih_A | 141 | Conserved protein with 2 CBS domains; bateman doma | 97.96 | |
| 2o16_A | 160 | Acetoin utilization protein ACUB, putative; struct | 97.95 | |
| 3fhm_A | 165 | Uncharacterized protein ATU1752; CBS domain, proka | 97.94 | |
| 1y5h_A | 133 | Hypothetical protein RV2626C; CBS domain, unknown | 97.93 | |
| 2p9m_A | 138 | Hypothetical protein MJ0922; structural genomics, | 97.93 | |
| 3ctu_A | 156 | CBS domain protein; structural genomics, PSI-2, pr | 97.92 | |
| 3jtf_A | 129 | Magnesium and cobalt efflux protein; CBS domain, C | 97.92 | |
| 3sl7_A | 180 | CBS domain-containing protein CBSX2; CBS-PAIR prot | 97.9 | |
| 2d4z_A | 250 | Chloride channel protein; CLC chloride channel cyt | 97.9 | |
| 2pfi_A | 164 | Chloride channel protein CLC-Ka; cystathionine bet | 97.86 | |
| 3i8n_A | 130 | Uncharacterized protein VP2912; APC64273.1, vibrio | 97.86 | |
| 3nqr_A | 127 | Magnesium and cobalt efflux protein CORC; structur | 97.85 | |
| 1o50_A | 157 | CBS domain-containing predicted protein TM0935; CB | 97.85 | |
| 3k6e_A | 156 | CBS domain protein; streptococcus pneumoniae TIGR4 | 97.85 | |
| 3hf7_A | 130 | Uncharacterized CBS-domain protein; CSB-domain PAI | 97.84 | |
| 3kxr_A | 205 | Magnesium transporter, putative; cystathionine bet | 97.84 | |
| 2uv4_A | 152 | 5'-AMP-activated protein kinase subunit gamma-1; t | 97.83 | |
| 3lqn_A | 150 | CBS domain protein; csgid, structural genomics, un | 97.83 | |
| 3oi8_A | 156 | Uncharacterized protein; structural genomics, PSI- | 97.81 | |
| 2nyc_A | 144 | Nuclear protein SNF4; bateman2 domain, AMP kinase, | 97.81 | |
| 2emq_A | 157 | Hypothetical conserved protein; CBS domains, NPPSF | 97.81 | |
| 1yav_A | 159 | Hypothetical protein BSU14130; cystathionine beta | 97.77 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 97.74 | |
| 3ocm_A | 173 | Putative membrane protein; structural genomics, PS | 97.71 | |
| 2j9l_A | 185 | Chloride channel protein 5; ION channel, ION trans | 97.71 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 97.69 | |
| 2yvy_A | 278 | MGTE, Mg2+ transporter MGTE; membrane protein, tra | 97.56 | |
| 2oux_A | 286 | Magnesium transporter; 10001B, structural genomics | 97.48 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 97.41 | |
| 3org_A | 632 | CMCLC; transporter, transport protein; 3.50A {Cyan | 97.35 | |
| 2zy9_A | 473 | Mg2+ transporter MGTE; membrane protien, metal tra | 97.26 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 97.23 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 97.06 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 97.06 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 96.79 | |
| 2cu0_A | 486 | Inosine-5'-monophosphate dehydrogenase; structural | 96.79 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 96.72 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 96.64 |
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
Probab=99.95 E-value=1.2e-27 Score=216.32 Aligned_cols=139 Identities=24% Similarity=0.460 Sum_probs=92.5
Q ss_pred cccCHHHHHHHHHhcccccccCCCCCHHHHHHHHHhhcccccccccccccCcceEEEeCCCChHHHHHHHHHhcCCceee
Q 014094 163 ALFRRAELKTLVNLHGNEAGKGGELTHDETTIIAGALELTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVP 242 (431)
Q Consensus 163 ~~~s~eEL~~lv~~~~~e~~~~G~L~~~E~~~i~~~l~l~~~tV~dIMtpr~~vvtv~~d~tv~~ea~~~m~~~~~sriP 242 (431)
..+|++||+.+++ +++++|.++++|++++++++.+.+.+|+++|+|+.+++++++++++. ++++.|.+++++++|
T Consensus 5 ~~~t~~el~~l~~----~~~~~g~l~~~e~~~i~~~~~l~~~~v~diM~~~~~~~~v~~~~~v~-~a~~~m~~~~~~~~p 79 (172)
T 3lhh_A 5 DNVTQEDIQAMLQ----EGSSAGVIEHNEHAMVKNVFRLDERTISSLMVPRSDIVFLDLNLPLD-ANLRTVMQSPHSRFP 79 (172)
T ss_dssp ------------------------------------------CTTTTSEEGGGCCCEETTSCHH-HHHHHHHTCCCSEEE
T ss_pred ccCCHHHHHHHHH----HHHHcCCCCHHHHHHHHHHhccCCCCHHHhCccHHHeEEEcCCCCHH-HHHHHHHhCCCCEEE
Confidence 4679999999997 45567999999999999999999999999999988999999999998 999999999999999
Q ss_pred eeeCCCCcEEEEEEhhhhhccCC-CCcccccccccCCCceecCCCCHHHHHHHHHhCCCeEEEEEe
Q 014094 243 VYYEEPTNIIGLILVKNLLTIHP-EDEVPVKSVTIRRIPRVPETLPLYEILNEFQKGHSHMAVVVR 307 (431)
Q Consensus 243 V~d~~~~~ivGIV~~kDLl~~~~-~~~~~V~dim~r~v~~V~~~~~l~~aL~~m~~~~~~~a~VVD 307 (431)
|++++.++++|+|+.+|++.... ....++.++| ++++++++++++.++++.|.+++.+.+||+|
T Consensus 80 Vvd~~~~~lvGivt~~dl~~~~~~~~~~~v~~im-~~~~~v~~~~~l~~a~~~m~~~~~~~~pVvd 144 (172)
T 3lhh_A 80 VCRNNVDDMVGIISAKQLLSESIAGERLELVDLV-KNCNFVPNSLSGMELLEHFRTTGSQMVFVVD 144 (172)
T ss_dssp EESSSTTSEEEEEEHHHHHHHHHTTCCCCGGGGC-BCCEEEETTCCHHHHHHHHHHHTCSEEEEEC
T ss_pred EEeCCCCeEEEEEEHHHHHHHHhhcCcccHHHHh-cCCeEeCCCCCHHHHHHHHHHcCCeEEEEEe
Confidence 99854379999999999987532 2357899998 9999999999999999999999999999999
|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3kh5_A Protein MJ1225; AMPK, AMP, ADP, ATP, CBS domain, archaea, unknown function; HET: ADP AMP; 2.10A {Methanocaldococcus jannaschii} PDB: 3lfz_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3t4n_C Nuclear protein SNF4; CBS domain, nucleotide binding, cytosol, protein binding; HET: ADP; 2.30A {Saccharomyces cerevisiae} PDB: 3tdh_C* 3te5_C* 2qlv_C | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3ddj_A CBS domain-containing protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.80A {Sulfolobus solfataricus} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >2yzq_A Putative uncharacterized protein PH1780; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; HET: SAM; 1.63A {Pyrococcus horikoshii} SCOP: d.37.1.1 d.37.1.1 | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2qrd_G Protein C1556.08C; AMPK, ADP, ATP-binding, kinase, nucleotide-binding, serine/T protein kinase, transferase, CBS domain; HET: ADP ATP; 2.41A {Schizosaccharomyces pombe} PDB: 2qrc_G* 2qr1_G* 2qre_G* 2oox_G* 2ooy_G* | Back alignment and structure |
|---|
| >2v8q_E 5'-AMP-activated protein kinase subunit gamma-1; phosphorylation, nucleotide-binding, serine/threonine-protei kinase, magnesium, CBS domain; HET: AMP; 2.10A {Rattus norvegicus} SCOP: d.37.1.1 d.37.1.1 PDB: 2v92_E* 2v9j_E* 2y8l_E* 2y8q_E* 2y94_E* 2ya3_E* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1vr9_A CBS domain protein/ACT domain protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE; 1.70A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >4esy_A CBS domain containing membrane protein; structural genomics, PSI-biology; 2.01A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3l2b_A Probable manganase-dependent inorganic pyrophosphatase; family II, CBS domain, bateman domain, AP4A, diadenosine polyphosphate, DRTGG; HET: B4P; 2.27A {Clostridium perfringens} PDB: 3l31_A* | Back alignment and structure |
|---|
| >3ghd_A A cystathionine beta-synthase domain protein FUSE ribbon-like domain; PF1953,APC40009,cystathionine beta-synthase domain protein; 1.81A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >4fry_A Putative signal-transduction protein with CBS DOM; CBS domain,ssgcid, structural genomics, niaid; HET: NAD AMP; 2.10A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3kpb_A Uncharacterized protein MJ0100; CBS domain, S-adenosylmethionine, conformational change, unknown function; HET: SAM; 1.60A {Methanocaldococcus jannaschii} SCOP: d.37.1.0 PDB: 3kpd_A* 3kpc_A* | Back alignment and structure |
|---|
| >3fv6_A YQZB protein; CBS domain dimer, metabolism regulator, central glycolytic G regulator, transcription; 1.95A {Bacillus subtilis} PDB: 3fwr_A* 3fws_A* | Back alignment and structure |
|---|
| >1pbj_A Hypothetical protein; structural genomics, domain, PSI, protein structure initiative; 1.40A {Methanothermobacter thermautotrophicusdelta H} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3gby_A Uncharacterized protein CT1051; CBS domain, structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3k2v_A Putative D-arabinose 5-phosphate isomerase; KPSF-like protein, CBS domain, structural genomics, PSI-2, P structure initiative; HET: MSE CMK; 1.95A {Klebsiella pneumoniae subsp} PDB: 3fna_A* | Back alignment and structure |
|---|
| >2yzi_A Hypothetical protein PH0107; sheet/helix/sheet/sheet/helix, structural genomics, unknown function, NPPSFA; 2.25A {Pyrococcus horikoshii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lhh_A CBS domain protein; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG, cell membrane; HET: MSE AMP; 2.10A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2rc3_A CBS domain; in SITU proteolysis, BR, structural genomics, PSI-2, protein structure initiative; HET: NAD; 1.60A {Nitrosomonas europaea atcc 19718} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2ef7_A Hypothetical protein ST2348; CBS-domain, structural genomics, NPPSFA, national project on structural and functional analyses; 2.10A {Sulfolobus tokodaii} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3lfr_A Putative metal ION transporter; CBS, AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 1.53A {Pseudomonas syringae} | Back alignment and structure |
|---|
| >3lv9_A Putative transporter; CBS domain, PSI, MCSG, structural genomics, protein structur initiative, midwest center for structural genomics; 2.40A {Clostridium difficile 630} | Back alignment and structure |
|---|
| >1pvm_A Conserved hypothetical protein TA0289; structural genomics, CBS domain, PSI, protein structure initiative; 1.50A {Thermoplasma acidophilum dsm 1728} SCOP: d.37.1.1 g.41.13.1 PDB: 2qh1_A | Back alignment and structure |
|---|
| >3oco_A Hemolysin-like protein containing CBS domains; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.20A {Oenococcus oeni} | Back alignment and structure |
|---|
| >4gqw_A CBS domain-containing protein CBSX1, chloroplasti; thioredoxin, plant, protein binding; 2.20A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2rih_A Conserved protein with 2 CBS domains; bateman domain, AMP binding protein, ligand-BIND protein; 2.10A {Pyrobaculum aerophilum} SCOP: d.37.1.1 PDB: 2rif_A | Back alignment and structure |
|---|
| >2o16_A Acetoin utilization protein ACUB, putative; structural genomics, unknown function, PSI-2, protein struct initiative; 1.90A {Vibrio cholerae} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3fhm_A Uncharacterized protein ATU1752; CBS domain, prokaryotic, bound nucleotide, AMP, NADH, struct genomics, PSI-2; HET: AMP NAI; 2.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1y5h_A Hypothetical protein RV2626C; CBS domain, unknown function; 1.50A {Mycobacterium tuberculosis} SCOP: d.37.1.1 PDB: 1xkf_A | Back alignment and structure |
|---|
| >2p9m_A Hypothetical protein MJ0922; structural genomics, collaboratory for structural genomics, secsg; 2.59A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} | Back alignment and structure |
|---|
| >3jtf_A Magnesium and cobalt efflux protein; CBS domain, CORC, AMP, structural genomics, PSI-2, protein S initiative; HET: MSE AMP; 2.00A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3sl7_A CBS domain-containing protein CBSX2; CBS-PAIR protein, redox regulator, plant CBS domain, thiored chloroplast, membrane protein; 1.91A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2d4z_A Chloride channel protein; CLC chloride channel cytoplasmic domain, CBS domains, ION CH regulatory subunit, transport protein; 3.10A {Torpedo marmorata} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >2pfi_A Chloride channel protein CLC-Ka; cystathionine beta synthetase (CBS) domains containing protein, transport protein; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3i8n_A Uncharacterized protein VP2912; APC64273.1, vibrio parahaemolyticus RIMD 2210633, structural genomics, PSI-2; 2.15A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3nqr_A Magnesium and cobalt efflux protein CORC; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: AMP; 2.00A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1o50_A CBS domain-containing predicted protein TM0935; CBS-domain PAIR fold, structural genomics, joint center for structural genomics, JCSG; 1.87A {Thermotoga maritima} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >3k6e_A CBS domain protein; streptococcus pneumoniae TIGR4, structural genomics, PSI-2, protein structure initiative; 2.81A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3hf7_A Uncharacterized CBS-domain protein; CSB-domain PAIR, AMP, PSI, MCSG, STR genomics, midwest center for structural genomics; HET: AMP; 2.75A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3kxr_A Magnesium transporter, putative; cystathionine beta-synthase, Mg2+ transporter, structural GE PSI-2, protein structure initiative; 2.41A {Shewanella oneidensis mr-1} | Back alignment and structure |
|---|
| >3lqn_A CBS domain protein; csgid, structural genomics, unknown function, center for structural genomics of infectious diseases; 1.80A {Bacillus anthracis} SCOP: d.37.1.0 | Back alignment and structure |
|---|
| >3oi8_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADN; 1.99A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2nyc_A Nuclear protein SNF4; bateman2 domain, AMP kinase, protein binding; 1.90A {Saccharomyces cerevisiae} SCOP: d.37.1.1 PDB: 2nye_A | Back alignment and structure |
|---|
| >2emq_A Hypothetical conserved protein; CBS domains, NPPSFA, national project on protein structural functional analyses; 2.50A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1yav_A Hypothetical protein BSU14130; cystathionine beta synthase (CBS) domain, structural genomics, protein structure initiative, PSI; 2.10A {Bacillus subtilis} SCOP: d.37.1.1 | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >3ocm_A Putative membrane protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: ADP; 1.80A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2j9l_A Chloride channel protein 5; ION channel, ION transport, voltage-gated; HET: ATP; 2.30A {Homo sapiens} SCOP: d.37.1.1 PDB: 2ja3_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >2yvy_A MGTE, Mg2+ transporter MGTE; membrane protein, transport protein; 2.30A {Thermus thermophilus} PDB: 2yvz_A | Back alignment and structure |
|---|
| >2oux_A Magnesium transporter; 10001B, structural genomics, PSI-2, P structure initiative, nysgxrc; 2.16A {Enterococcus faecalis} SCOP: a.118.26.1 d.37.1.1 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >3org_A CMCLC; transporter, transport protein; 3.50A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >2zy9_A Mg2+ transporter MGTE; membrane protien, metal transport; 2.94A {Thermus thermophilus} PDB: 2yvx_A | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >2cu0_A Inosine-5'-monophosphate dehydrogenase; structural genomics, pyrococcus horikoshii OT3, riken structural genomics/PROT initiative, RSGI; HET: XMP; 2.10A {Pyrococcus horikoshii} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 431 | ||||
| d2v8qe2 | 159 | d.37.1.1 (E:23-181) 5'-AMP-activated protein kinas | 1e-09 | |
| d2ooxe1 | 179 | d.37.1.1 (E:3-181) Uncharacterized protein C1556.0 | 3e-07 | |
| d2j9la1 | 169 | d.37.1.1 (A:578-746) Chloride channel protein 5, C | 6e-05 | |
| d2nyca1 | 140 | d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's | 8e-05 | |
| d1pvma4 | 142 | d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Ar | 1e-04 | |
| d2yzqa1 | 156 | d.37.1.1 (A:123-278) Uncharacterized protein PH178 | 2e-04 | |
| d2v8qe1 | 145 | d.37.1.1 (E:182-326) 5'-AMP-activated protein kina | 4e-04 | |
| d3ddja1 | 141 | d.37.1.1 (A:136-276) Uncharacterized protein SSO32 | 4e-04 |
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 159 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: 5'-AMP-activated protein kinase subunit gamma-1, AMPKg species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 54.4 bits (130), Expect = 1e-09
Identities = 10/125 (8%), Positives = 40/125 (32%), Gaps = 20/125 (16%)
Query: 201 LTEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVKNL 260
+ D + ++ D + ++ K+ ++ G P++ + + +G++ + +
Sbjct: 10 MKSHRCYDLIPTSSKLVVFDTSLQV-KKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDF 68
Query: 261 LTI-------------------HPEDEVPVKSVTIRRIPRVPETLPLYEILNEFQKGHSH 301
+ I + + + + L++ ++ + H
Sbjct: 69 INILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIH 128
Query: 302 MAVVV 306
V+
Sbjct: 129 RLPVI 133
|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} Length = 179 | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 169 | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 142 | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} Length = 156 | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} Length = 141 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 431 | |||
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.8 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 99.8 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 99.78 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 99.77 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 99.77 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.77 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 99.76 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 99.76 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 99.75 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 99.75 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 99.74 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.74 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 99.74 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 99.74 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 99.73 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.73 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 99.73 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 99.72 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 99.7 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 99.67 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 99.67 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 99.66 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 99.66 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 99.65 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 99.65 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 99.59 | |
| d2ouxa2 | 127 | Magnesium transporter MgtE {Enterococcus faecalis | 98.36 | |
| d2yzia1 | 132 | Uncharacterized protein PH0107 {Pyrococcus horikos | 98.35 | |
| d1pbja3 | 120 | Hypothetical protein MTH1622 {Archaeon Methanobact | 98.26 | |
| d3ddja2 | 135 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 98.23 | |
| d1y5ha3 | 123 | Hypothetical protein Rv2626c {Mycobacterium tuberc | 98.23 | |
| d2ef7a1 | 127 | Uncharacterized protein ST2348 {Sulfolobus tokodai | 98.22 | |
| d2yzqa1 | 156 | Uncharacterized protein PH1780 {Pyrococcus horikos | 98.22 | |
| d2o16a3 | 139 | Hypothetical protein VC0737 {Vibrio cholerae [TaxI | 98.17 | |
| d1pvma4 | 142 | Hypothetical protein Ta0289 {Archaeon Thermoplasma | 98.16 | |
| d1jr1a4 | 120 | Type II inosine monophosphate dehydrogenase CBS do | 98.15 | |
| d2yvxa2 | 144 | Magnesium transporter MgtE {Thermus thermophilus [ | 98.14 | |
| d2rc3a1 | 127 | Uncharacterized protein NE2398 {Nitrosomonas europ | 98.04 | |
| d1yava3 | 132 | Hypothetical protein YkuL {Bacillus subtilis [TaxI | 98.03 | |
| d2yzqa2 | 122 | Uncharacterized protein PH1780 {Pyrococcus horikos | 97.98 | |
| d3ddja1 | 141 | Uncharacterized protein SSO3205 {Sulfolobus solfat | 97.98 | |
| d1o50a3 | 145 | Hypothetical protein TM0935 {Thermotoga maritima [ | 97.96 | |
| d2riha1 | 131 | Uncharacterized protein PAE2072 {Pyrobaculum aerop | 97.95 | |
| d2d4za3 | 160 | Chloride channel protein, CBS tandem {Marbled elec | 97.95 | |
| d2j9la1 | 169 | Chloride channel protein 5, ClC-5 {Human (Homo sap | 97.89 | |
| d1vr9a3 | 121 | Hypothetical protein TM0892, CBS tandem {Thermotog | 97.88 | |
| d1zfja4 | 126 | Type II inosine monophosphate dehydrogenase CBS do | 97.87 | |
| d2v8qe2 | 159 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.75 | |
| d2nyca1 | 140 | Nuclear protein SNF4 {Baker's yeast (Saccharomyces | 97.75 | |
| d2ooxe2 | 153 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.66 | |
| d2v8qe1 | 145 | 5'-AMP-activated protein kinase subunit gamma-1, A | 97.57 | |
| d2ooxe1 | 179 | Uncharacterized protein C1556.08c {Schizosaccharom | 97.28 |
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: CBS-domain pair superfamily: CBS-domain pair family: CBS-domain pair domain: Uncharacterized protein C1556.08c species: Schizosaccharomyces pombe [TaxId: 4896]
Probab=99.80 E-value=3.7e-20 Score=165.74 Aligned_cols=123 Identities=9% Similarity=0.126 Sum_probs=105.7
Q ss_pred CHHHHHHHHHhhcc-cccccccccccCcceEEEeCCCChHHHHHHHHHhcCCceeeeeeCCCCcEEEEEEhhhhhccC--
Q 014094 188 THDETTIIAGALEL-TEKTASDAMTPIAETFAIDINAKLDKELMNLILEKGHSRVPVYYEEPTNIIGLILVKNLLTIH-- 264 (431)
Q Consensus 188 ~~~E~~~i~~~l~l-~~~tV~dIMtpr~~vvtv~~d~tv~~ea~~~m~~~~~sriPV~d~~~~~ivGIV~~kDLl~~~-- 264 (431)
.+.++..++.+.+| .+.++.|+|++..+++++++++++. +|++.|.+++++++||+|++.++++|+++.+|++...
T Consensus 3 ~~~~~~~~~~i~~fl~~~~~~dvm~~s~~vv~i~~~~~v~-~A~~~m~~~~i~~lpVvd~~~~~~vGiis~~Di~~~l~~ 81 (179)
T d2ooxe1 3 QETQKGALKEIQAFIRSRTSYDVLPTSFRLIVFDVTLFVK-TSLSLLTLNNIVSAPLWDSEANKFAGLLTMADFVNVIKY 81 (179)
T ss_dssp HHHHHHHHHHHHHHHHHSBHHHHSCSEEEEEEEETTSBHH-HHHHHHHHHTCSCEEEEETTTTEEEEEECHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHcCCEeeeeCCCCCcEEEEECcchHH-HHHHHHHHcCCCeEEEEeCCCCeeEEEEeechHHHHHHh
Confidence 46678888888886 9999999999888999999999998 9999999999999999997668999999999997531
Q ss_pred ----CC---C--------------cccccccccCCCceecCCCCHHHHHHHHHhCCCeEEEEEecCCC
Q 014094 265 ----PE---D--------------EVPVKSVTIRRIPRVPETLPLYEILNEFQKGHSHMAVVVRQYNK 311 (431)
Q Consensus 265 ----~~---~--------------~~~V~dim~r~v~~V~~~~~l~~aL~~m~~~~~~~a~VVDEyG~ 311 (431)
.. . ...+..+|.++++++++++++.+++..|.+++.|.+||+|++|.
T Consensus 82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~v~~~~sl~~~~~~m~~~~~~~lpVvd~~g~ 149 (179)
T d2ooxe1 82 YYQSSSFPEAIAEIDKFRLLGLREVERKIGAIPPETIYVHPMHSLMDACLAMSKSRARRIPLIDVDGE 149 (179)
T ss_dssp HHHHCSCGGGGGGGGGSBHHHHHHHHHHTTCSCSSCCCBCTTSBHHHHHHHHHHTTCSEEEEEEECTT
T ss_pred ccccccchhhhhhhhccchhhhcccceeeeecccCceEECCCCcHHHHHHHhhhcCceEEEEEecCCC
Confidence 00 0 11234567899999999999999999999999999999997665
|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2yzia1 d.37.1.1 (A:4-135) Uncharacterized protein PH0107 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1pbja3 d.37.1.1 (A:2-121) Hypothetical protein MTH1622 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d3ddja2 d.37.1.1 (A:1-135) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1y5ha3 d.37.1.1 (A:2-124) Hypothetical protein Rv2626c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2yzqa1 d.37.1.1 (A:123-278) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2o16a3 d.37.1.1 (A:20-158) Hypothetical protein VC0737 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1pvma4 d.37.1.1 (A:1-142) Hypothetical protein Ta0289 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jr1a4 d.37.1.1 (A:113-232) Type II inosine monophosphate dehydrogenase CBS domains {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2yvxa2 d.37.1.1 (A:132-275) Magnesium transporter MgtE {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2rc3a1 d.37.1.1 (A:23-149) Uncharacterized protein NE2398 {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1yava3 d.37.1.1 (A:13-144) Hypothetical protein YkuL {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2yzqa2 d.37.1.1 (A:1-122) Uncharacterized protein PH1780 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d3ddja1 d.37.1.1 (A:136-276) Uncharacterized protein SSO3205 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1o50a3 d.37.1.1 (A:1-145) Hypothetical protein TM0935 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2riha1 d.37.1.1 (A:2-132) Uncharacterized protein PAE2072 {Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]} | Back information, alignment and structure |
|---|
| >d2j9la1 d.37.1.1 (A:578-746) Chloride channel protein 5, ClC-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zfja4 d.37.1.1 (A:95-220) Type II inosine monophosphate dehydrogenase CBS domains {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2v8qe2 d.37.1.1 (E:23-181) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nyca1 d.37.1.1 (A:181-320) Nuclear protein SNF4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ooxe2 d.37.1.1 (E:182-334) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2v8qe1 d.37.1.1 (E:182-326) 5'-AMP-activated protein kinase subunit gamma-1, AMPKg {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ooxe1 d.37.1.1 (E:3-181) Uncharacterized protein C1556.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|