Citrus Sinensis ID: 014098


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MATRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLSHNDVSLGMSRRSSNSGSGSVEIPEFLRQRPHIYHPRA
cccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccHHHHHHHHHccccEEEEEEEEcHHHHHHccccccccEEEcccccccccccccccHHHHHHHHHcHHHHHHHHccccEEEEcccccccccccHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHHHcccEEECcccccccHHHHHHHHHccccEEEEcccccccHHHHHHHHHHHHccccccccccccEEEEEECccccccHHHHHHHHHHHHHHccccccEEEEEEEccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccHHcccccccccccc
*******CFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSA**********************************************************EAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKG************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRISTCFAPSHTCISKETQISRASSVKILDYRSDSWGACPRNVKDFLRLKCSAKAHNVSPNHSKDPFLDLHPEVSMLSGDGTNVLFGSMKEGLGKSVSESLRQSSVPNNNNEAKIKVIGVGGGGSNAVNRMIESSMTGVEFWIVNTDAQAMKVSPVIPENRLQIGCDLTRGLGAGGNPSVGMNAANESKVAIEEAISGADMIFVTAGMGGGTGTGAAPVIAGIAKSMGILTVGIATVPFCFEGRRRAIQAQEGVANLRNNVDTLIIPGLVNVDFADVRAIMKDAGSSLMGIGTATGKSRARDAALNAIQSPLLDIGIETATGIVWNITGGTDLTLFEVNTAAEVIYDLVDPSANLIFGAVIDKSLSNQVSITLIATGFKGDKLEGKGTHLSHNDVSLGMSRRSSNSGSGSVEIPEFLRQRPHIYHPRA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cell division protein FtsZ homolog 2-1, chloroplastic Exhibits GTPase activity. Component of the plastid division machinery that forms a contractile ring at the division site. Required for plastid division in a dose-dependent manner.probableO82533
Cell division protein FtsZ Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.probableP94337
Cell division protein FtsZ Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the timing and the location of cell division. One of the functions of the FtsZ ring is to recruit other cell division proteins to the septum to produce a new cell wall between the dividing cells. Binds GTP and shows GTPase activity.probableP45482

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DXD, chain A
Confidence level:very confident
Coverage over the Query: 115-383
View the alignment between query and template
View the model in PyMOL